Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3013693..3014321 | Replicon | chromosome |
Accession | NZ_CP100475 | ||
Organism | Mesorhizobium sp. C372A |
Toxin (Protein)
Gene name | vapC | Uniprot ID | V7HPF9 |
Locus tag | NLY42_RS14320 | Protein ID | WP_023724991.1 |
Coordinates | 3013935..3014321 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | X6KRM4 |
Locus tag | NLY42_RS14315 | Protein ID | WP_023724992.1 |
Coordinates | 3013693..3013938 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLY42_RS14285 (NLY42_14300) | 3008802..3009554 | - | 753 | WP_023669968.1 | SDR family NAD(P)-dependent oxidoreductase | - |
NLY42_RS14290 (NLY42_14305) | 3009600..3010688 | - | 1089 | WP_023754959.1 | AbrB family transcriptional regulator | - |
NLY42_RS14295 (NLY42_14310) | 3010769..3011077 | - | 309 | WP_023691624.1 | putative quinol monooxygenase | - |
NLY42_RS14300 (NLY42_14315) | 3011157..3011936 | - | 780 | WP_023686180.1 | SDR family oxidoreductase | - |
NLY42_RS14305 (NLY42_14320) | 3012010..3012438 | - | 429 | WP_023754958.1 | DsrE family protein | - |
NLY42_RS14310 (NLY42_14325) | 3012539..3013627 | + | 1089 | WP_023754957.1 | hypothetical protein | - |
NLY42_RS14315 (NLY42_14330) | 3013693..3013938 | + | 246 | WP_023724992.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NLY42_RS14320 (NLY42_14335) | 3013935..3014321 | + | 387 | WP_023724991.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NLY42_RS14325 (NLY42_14340) | 3014328..3015275 | - | 948 | WP_023754956.1 | cation diffusion facilitator family transporter | - |
NLY42_RS14330 (NLY42_14345) | 3015281..3017470 | - | 2190 | WP_023754955.1 | anthranilate synthase | - |
NLY42_RS14335 (NLY42_14350) | 3017791..3018561 | + | 771 | WP_023695831.1 | isocitrate lyase/phosphoenolpyruvate mutase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14208.29 Da Isoelectric Point: 5.6660
>T250570 WP_023724991.1 NZ_CP100475:3013935-3014321 [Mesorhizobium sp. C372A]
VTYLLDTNAVIAIIAGDEGLLALLKRHAPQDFALSAVVLHELYYGAEKSQRKVQNLARIEALQFPVLEFDRDDARHAGEI
RAGLAALGTPIGPYDALIGGQARARDLTLITRNIREFERIKDLTIETW
VTYLLDTNAVIAIIAGDEGLLALLKRHAPQDFALSAVVLHELYYGAEKSQRKVQNLARIEALQFPVLEFDRDDARHAGEI
RAGLAALGTPIGPYDALIGGQARARDLTLITRNIREFERIKDLTIETW
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|