Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 5718821..5719488 | Replicon | chromosome |
Accession | NZ_CP100472 | ||
Organism | Mesorhizobium sp. C399B |
Toxin (Protein)
Gene name | vapC | Uniprot ID | X6IYQ3 |
Locus tag | NLY36_RS27180 | Protein ID | WP_023695548.1 |
Coordinates | 5719072..5719488 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V7HL59 |
Locus tag | NLY36_RS27175 | Protein ID | WP_023670289.1 |
Coordinates | 5718821..5719075 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLY36_RS27150 (NLY36_27100) | 5714313..5715020 | - | 708 | WP_023689060.1 | phosphoribosylglycinamide formyltransferase | - |
NLY36_RS27155 (NLY36_27105) | 5715017..5716096 | - | 1080 | WP_023689059.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
NLY36_RS27160 (NLY36_27110) | 5716284..5716825 | + | 542 | Protein_5379 | CDP-alcohol phosphatidyltransferase family protein | - |
NLY36_RS27165 (NLY36_27115) | 5716797..5717990 | + | 1194 | WP_023695549.1 | AI-2E family transporter | - |
NLY36_RS27170 (NLY36_27120) | 5717993..5718697 | + | 705 | WP_023689058.1 | DnaA regulatory inactivator HdaA | - |
NLY36_RS27175 (NLY36_27125) | 5718821..5719075 | + | 255 | WP_023670289.1 | plasmid stabilization protein | Antitoxin |
NLY36_RS27180 (NLY36_27130) | 5719072..5719488 | + | 417 | WP_023695548.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NLY36_RS27185 (NLY36_27135) | 5719796..5720056 | - | 261 | WP_023689056.1 | hypothetical protein | - |
NLY36_RS27190 (NLY36_27140) | 5720448..5720759 | - | 312 | WP_023689055.1 | hypothetical protein | - |
NLY36_RS27200 (NLY36_27150) | 5721067..5722251 | - | 1185 | WP_023695547.1 | NAD(P)/FAD-dependent oxidoreductase | - |
NLY36_RS27205 (NLY36_27155) | 5722425..5722730 | + | 306 | WP_023670294.1 | ETC complex I subunit | - |
NLY36_RS27220 (NLY36_27170) | 5723092..5723427 | + | 336 | WP_031198108.1 | hypothetical protein | - |
NLY36_RS27225 (NLY36_27175) | 5723460..5724317 | + | 858 | WP_198031602.1 | alpha/beta hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14813.02 Da Isoelectric Point: 6.0769
>T250568 WP_023695548.1 NZ_CP100472:5719072-5719488 [Mesorhizobium sp. C399B]
MILLDTNVVSEAMKPEPHQAVLAWLDNQAEETLYLSSVTLAEVLFGIEAMPAGRRKAALAETFAGVCAVFERRILPFDTE
AARHYARLAVKARAAGKGFPVPDGYIAAIASANGFHLASRDTAPFHAAGVPVIDPWQP
MILLDTNVVSEAMKPEPHQAVLAWLDNQAEETLYLSSVTLAEVLFGIEAMPAGRRKAALAETFAGVCAVFERRILPFDTE
AARHYARLAVKARAAGKGFPVPDGYIAAIASANGFHLASRDTAPFHAAGVPVIDPWQP
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|