Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
Location | 1108285..1108955 | Replicon | chromosome |
Accession | NZ_CP100472 | ||
Organism | Mesorhizobium sp. C399B |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NLY36_RS05330 | Protein ID | WP_023696188.1 |
Coordinates | 1108285..1108683 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | X6J8K0 |
Locus tag | NLY36_RS05335 | Protein ID | WP_023687970.1 |
Coordinates | 1108683..1108955 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLY36_RS05305 (NLY36_05285) | 1103474..1104157 | + | 684 | WP_023735998.1 | M15 family metallopeptidase | - |
NLY36_RS05310 (NLY36_05290) | 1104388..1105416 | + | 1029 | WP_023673082.1 | sulfate ABC transporter substrate-binding protein | - |
NLY36_RS05315 (NLY36_05295) | 1105435..1106286 | + | 852 | WP_023735999.1 | sulfate ABC transporter permease subunit CysT | - |
NLY36_RS05320 (NLY36_05300) | 1106279..1107163 | + | 885 | WP_023690809.1 | sulfate ABC transporter permease subunit CysW | - |
NLY36_RS05325 (NLY36_05305) | 1107237..1108277 | + | 1041 | WP_023696187.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
NLY36_RS05330 (NLY36_05310) | 1108285..1108683 | - | 399 | WP_023696188.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NLY36_RS05335 (NLY36_05315) | 1108683..1108955 | - | 273 | WP_023687970.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NLY36_RS05340 (NLY36_05320) | 1109197..1110183 | + | 987 | WP_023736000.1 | sulfate ABC transporter substrate-binding protein | - |
NLY36_RS05345 (NLY36_05325) | 1110443..1110892 | + | 450 | WP_023673075.1 | Rrf2 family transcriptional regulator | - |
NLY36_RS05350 (NLY36_05330) | 1110958..1112526 | - | 1569 | WP_023696191.1 | acyl--CoA ligase | - |
NLY36_RS05355 (NLY36_05335) | 1112613..1113758 | + | 1146 | WP_023696192.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 13999.23 Da Isoelectric Point: 5.7200
>T250567 WP_023696188.1 NZ_CP100472:c1108683-1108285 [Mesorhizobium sp. C399B]
MRFMLDTNILSDMIRNPAGKAASTAVCAGDGALCTSIVVASELRYGCARKGSAKLLAKVEQLLAELPVLPLDVPVDAEYG
ALRAELEARSQVIGHNDLFIAAHACALGTTLVTANTGEFSRIKGLKVENWLE
MRFMLDTNILSDMIRNPAGKAASTAVCAGDGALCTSIVVASELRYGCARKGSAKLLAKVEQLLAELPVLPLDVPVDAEYG
ALRAELEARSQVIGHNDLFIAAHACALGTTLVTANTGEFSRIKGLKVENWLE
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|