Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 5536915..5537485 | Replicon | chromosome |
| Accession | NZ_CP100443 | ||
| Organism | Streptomyces rimosus subsp. rimosus strain DV3 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | L8ERH5 |
| Locus tag | SRIMDV3_RS24080 | Protein ID | WP_003982453.1 |
| Coordinates | 5537138..5537485 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | L8ERT3 |
| Locus tag | SRIMDV3_RS24075 | Protein ID | WP_003982452.1 |
| Coordinates | 5536915..5537151 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SRIMDV3_RS24060 (SRIMDV3_24165) | 5532337..5533494 | + | 1158 | WP_003982449.1 | allantoicase | - |
| SRIMDV3_RS24065 (SRIMDV3_24170) | 5533566..5536142 | - | 2577 | WP_003982450.1 | aminopeptidase N | - |
| SRIMDV3_RS24070 (SRIMDV3_24175) | 5536276..5536875 | + | 600 | WP_003982451.1 | Uma2 family endonuclease | - |
| SRIMDV3_RS24075 (SRIMDV3_24180) | 5536915..5537151 | + | 237 | WP_003982452.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| SRIMDV3_RS24080 (SRIMDV3_24185) | 5537138..5537485 | + | 348 | WP_003982453.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| SRIMDV3_RS24085 (SRIMDV3_24190) | 5537566..5538087 | + | 522 | WP_003982454.1 | DUF1203 domain-containing protein | - |
| SRIMDV3_RS24090 (SRIMDV3_24195) | 5538158..5539189 | - | 1032 | WP_003982455.1 | aspartate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12493.43 Da Isoelectric Point: 10.8691
>T250565 WP_003982453.1 NZ_CP100443:5537138-5537485 [Streptomyces rimosus subsp. rimosus]
MRRGDLYLVDLEPVRGSEANKYRPAVVVSNDAANRSVQRAGRGVVTVVPVTANVARVYPFQVLLTADDCGLPRDSKAQCE
QVRAVSVERLGRRVGSVPARVMVGLDAALRRHLAL
MRRGDLYLVDLEPVRGSEANKYRPAVVVSNDAANRSVQRAGRGVVTVVPVTANVARVYPFQVLLTADDCGLPRDSKAQCE
QVRAVSVERLGRRVGSVPARVMVGLDAALRRHLAL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|