Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 509837..510473 | Replicon | chromosome |
Accession | NZ_CP100436 | ||
Organism | Bacillus subtilis strain MEC_B298 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NLK52_RS02590 | Protein ID | WP_003156187.1 |
Coordinates | 510123..510473 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | NLK52_RS02585 | Protein ID | WP_003225183.1 |
Coordinates | 509837..510118 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLK52_RS02565 (NLK52_02565) | 506196..506795 | - | 600 | WP_015482831.1 | rhomboid family intramembrane serine protease | - |
NLK52_RS02570 (NLK52_02570) | 506890..507255 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
NLK52_RS02575 (NLK52_02575) | 507421..508437 | + | 1017 | WP_080030712.1 | outer membrane lipoprotein carrier protein LolA | - |
NLK52_RS02580 (NLK52_02580) | 508552..509721 | + | 1170 | WP_015382833.1 | alanine racemase | - |
NLK52_RS02585 (NLK52_02585) | 509837..510118 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NLK52_RS02590 (NLK52_02590) | 510123..510473 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NLK52_RS02595 (NLK52_02595) | 510589..511413 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
NLK52_RS02600 (NLK52_02600) | 511418..511783 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
NLK52_RS02605 (NLK52_02605) | 511787..512188 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
NLK52_RS02610 (NLK52_02610) | 512200..513207 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
NLK52_RS02615 (NLK52_02615) | 513269..513598 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
NLK52_RS02620 (NLK52_02620) | 513595..514077 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
NLK52_RS02625 (NLK52_02625) | 514043..514831 | + | 789 | WP_015482833.1 | RNA polymerase sigma factor SigB | - |
NLK52_RS02630 (NLK52_02630) | 514831..515430 | + | 600 | WP_015382836.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T250561 WP_003156187.1 NZ_CP100436:510123-510473 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|