Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 2072739..2073345 | Replicon | chromosome |
| Accession | NZ_CP100432 | ||
| Organism | Streptococcus suis T15 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A0Z8ZB64 |
| Locus tag | NLY75_RS10440 | Protein ID | WP_012775364.1 |
| Coordinates | 2072739..2073068 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A822VQD8 |
| Locus tag | NLY75_RS10445 | Protein ID | WP_023371687.1 |
| Coordinates | 2073058..2073345 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLY75_RS10410 (NLY75_10410) | 2068155..2069885 | - | 1731 | WP_023371683.1 | membrane protein | - |
| NLY75_RS10415 (NLY75_10415) | 2070248..2071120 | - | 873 | WP_014736465.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| NLY75_RS10420 (NLY75_10420) | 2071139..2071609 | - | 471 | WP_023371685.1 | DUF1697 domain-containing protein | - |
| NLY75_RS10425 (NLY75_10425) | 2071682..2071939 | - | 258 | WP_013730620.1 | Txe/YoeB family addiction module toxin | - |
| NLY75_RS10430 (NLY75_10430) | 2071941..2072201 | - | 261 | WP_002939010.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NLY75_RS10435 (NLY75_10435) | 2072277..2072732 | - | 456 | WP_012028534.1 | 8-oxo-dGTP diphosphatase | - |
| NLY75_RS10440 (NLY75_10440) | 2072739..2073068 | - | 330 | WP_012775364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLY75_RS10445 (NLY75_10445) | 2073058..2073345 | - | 288 | WP_023371687.1 | hypothetical protein | Antitoxin |
| NLY75_RS10450 (NLY75_10450) | 2073443..2073811 | - | 369 | WP_023371689.1 | hypothetical protein | - |
| NLY75_RS10455 (NLY75_10455) | 2073804..2074373 | - | 570 | WP_012775700.1 | ribonuclease M5 | - |
| NLY75_RS10460 (NLY75_10460) | 2074357..2075139 | - | 783 | WP_012028536.1 | TatD family hydrolase | - |
| NLY75_RS10465 (NLY75_10465) | 2075246..2075383 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
| NLY75_RS10470 (NLY75_10470) | 2075626..2076712 | + | 1087 | Protein_2027 | IS30 family transposase | - |
| NLY75_RS10475 (NLY75_10475) | 2077024..2078019 | - | 996 | WP_023371691.1 | RNA-binding cell elongation regulator Jag/EloR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2075795..2076712 | 917 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12562.52 Da Isoelectric Point: 7.1991
>T250560 WP_012775364.1 NZ_CP100432:c2073068-2072739 [Streptococcus suis T15]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Z8ZB64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A822VQD8 |