Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1605152..1605826 | Replicon | chromosome |
| Accession | NZ_CP100432 | ||
| Organism | Streptococcus suis T15 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A123U128 |
| Locus tag | NLY75_RS08100 | Protein ID | WP_009910449.1 |
| Coordinates | 1605152..1605334 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A123TH46 |
| Locus tag | NLY75_RS08105 | Protein ID | WP_023371005.1 |
| Coordinates | 1605374..1605826 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLY75_RS08070 (NLY75_08070) | 1600444..1600716 | + | 273 | WP_041179486.1 | DNA-binding protein | - |
| NLY75_RS08075 (NLY75_08075) | 1600713..1601576 | + | 864 | WP_023370995.1 | primase alpha helix C-terminal domain-containing protein | - |
| NLY75_RS08080 (NLY75_08080) | 1601636..1603096 | + | 1461 | WP_041179505.1 | DNA primase family protein | - |
| NLY75_RS08085 (NLY75_08085) | 1603431..1603871 | + | 441 | WP_023370999.1 | hypothetical protein | - |
| NLY75_RS08090 (NLY75_08090) | 1603941..1604441 | + | 501 | WP_023371001.1 | hypothetical protein | - |
| NLY75_RS08095 (NLY75_08095) | 1604582..1604968 | + | 387 | WP_023371003.1 | hypothetical protein | - |
| NLY75_RS08100 (NLY75_08100) | 1605152..1605334 | + | 183 | WP_009910449.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NLY75_RS08105 (NLY75_08105) | 1605374..1605826 | + | 453 | WP_023371005.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NLY75_RS08110 (NLY75_08110) | 1605938..1606147 | + | 210 | WP_023371007.1 | hypothetical protein | - |
| NLY75_RS08115 (NLY75_08115) | 1606799..1607149 | - | 351 | WP_228476898.1 | hypothetical protein | - |
| NLY75_RS08120 (NLY75_08120) | 1607143..1607622 | - | 480 | WP_023371011.1 | hypothetical protein | - |
| NLY75_RS08125 (NLY75_08125) | 1607624..1608418 | - | 795 | WP_023371013.1 | hypothetical protein | - |
| NLY75_RS08130 (NLY75_08130) | 1608420..1608737 | - | 318 | WP_023371015.1 | PadR family transcriptional regulator | - |
| NLY75_RS08135 (NLY75_08135) | 1608734..1608898 | - | 165 | WP_023371017.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1595200..1608898 | 13698 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6681.93 Da Isoelectric Point: 10.8207
>T250558 WP_009910449.1 NZ_CP100432:1605152-1605334 [Streptococcus suis T15]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKVGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKVGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16685.68 Da Isoelectric Point: 4.0098
>AT250558 WP_023371005.1 NZ_CP100432:1605374-1605826 [Streptococcus suis T15]
MLVTYPALFYYDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPTPINALSLADNNPF
RDDKDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPTPINALSLADNNPF
RDDKDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A123U128 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A123TH46 |