Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1385330..1385816 | Replicon | chromosome |
| Accession | NZ_CP100432 | ||
| Organism | Streptococcus suis T15 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D5AGV2 |
| Locus tag | NLY75_RS06960 | Protein ID | WP_011922754.1 |
| Coordinates | 1385330..1385599 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | D5AGV1 |
| Locus tag | NLY75_RS06965 | Protein ID | WP_002938604.1 |
| Coordinates | 1385589..1385816 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLY75_RS06935 (NLY75_06935) | 1380383..1381300 | - | 918 | WP_002937252.1 | DNA-binding protein WhiA | - |
| NLY75_RS06940 (NLY75_06940) | 1381297..1382271 | - | 975 | WP_002937257.1 | YvcK family protein | - |
| NLY75_RS06945 (NLY75_06945) | 1382268..1383155 | - | 888 | WP_011922160.1 | RNase adapter RapZ | - |
| NLY75_RS06950 (NLY75_06950) | 1383177..1383554 | - | 378 | WP_002937263.1 | RidA family protein | - |
| NLY75_RS06955 (NLY75_06955) | 1383605..1384924 | - | 1320 | WP_012775027.1 | MATE family efflux transporter | - |
| NLY75_RS06960 (NLY75_06960) | 1385330..1385599 | - | 270 | WP_011922754.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLY75_RS06965 (NLY75_06965) | 1385589..1385816 | - | 228 | WP_002938604.1 | DUF6290 family protein | Antitoxin |
| NLY75_RS06970 (NLY75_06970) | 1386088..1387434 | - | 1347 | WP_011922752.1 | asparagine--tRNA ligase | - |
| NLY75_RS06975 (NLY75_06975) | 1387449..1388630 | - | 1182 | WP_011922154.1 | pyridoxal phosphate-dependent aminotransferase | - |
| NLY75_RS06980 (NLY75_06980) | 1388627..1389124 | - | 498 | WP_011922751.1 | DUF5590 domain-containing protein | - |
| NLY75_RS06990 (NLY75_06990) | 1390324..1390773 | + | 450 | WP_009909619.1 | MarR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10437.49 Da Isoelectric Point: 10.3916
>T250557 WP_011922754.1 NZ_CP100432:c1385599-1385330 [Streptococcus suis T15]
MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGKALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEI
GHRKEIYKK
MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGKALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEI
GHRKEIYKK
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A126UKS2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140EXF0 |