Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 956148..956634 Replicon chromosome
Accession NZ_CP100431
Organism Streptococcus suis strain 1521251

Toxin (Protein)


Gene name relE Uniprot ID A0A0K2E5U8
Locus tag NLY77_RS04845 Protein ID WP_002935012.1
Coordinates 956148..956405 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0K2E5B0
Locus tag NLY77_RS04850 Protein ID WP_002935014.1
Coordinates 956395..956634 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLY77_RS04825 (NLY77_04825) 951782..952852 + 1071 WP_002935006.1 tyrosine recombinase XerS -
NLY77_RS04830 (NLY77_04830) 952922..954430 - 1509 WP_013730362.1 phosphoglucomutase -
NLY77_RS04835 (NLY77_04835) 954506..955447 - 942 WP_002935009.1 sensor histidine kinase -
NLY77_RS04840 (NLY77_04840) 955444..956109 - 666 WP_009909826.1 response regulator transcription factor -
NLY77_RS04845 (NLY77_04845) 956148..956405 - 258 WP_002935012.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NLY77_RS04850 (NLY77_04850) 956395..956634 - 240 WP_002935014.1 DUF6290 family protein Antitoxin
NLY77_RS04855 (NLY77_04855) 956726..957193 - 468 Protein_924 ABC transporter permease -
NLY77_RS04860 (NLY77_04860) 957309..958313 - 1005 WP_002935211.1 IS5 family transposase -
NLY77_RS04865 (NLY77_04865) 958363..958626 - 264 WP_254410590.1 hypothetical protein -
NLY77_RS04870 (NLY77_04870) 958599..959519 - 921 WP_254410591.1 hypothetical protein -
NLY77_RS04875 (NLY77_04875) 959470..959883 - 414 WP_254410592.1 FtsX-like permease family protein -
NLY77_RS04880 (NLY77_04880) 959884..960636 - 753 WP_011922409.1 ABC transporter ATP-binding protein -
NLY77_RS04885 (NLY77_04885) 960772..961506 - 735 WP_011922410.1 ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 957309..958313 1004


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-75)

Antitoxin

Protein of unknown function DUF6290

(1-74)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 9849.52 Da        Isoelectric Point: 10.7134

>T250552 WP_002935012.1 NZ_CP100431:c956405-956148 [Streptococcus suis]
MSYKVILSAKAQKQIRKMDKTAASLILRYLYKHIDGCDNPRQYGKALTANRSGQWRYRIGNYRVIVNIEDDKLIVTSIKM
RNGSI

Download         Length: 258 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8924.19 Da        Isoelectric Point: 3.9191

>AT250552 WP_002935014.1 NZ_CP100431:c956634-956395 [Streptococcus suis]
MAAITLKVSEQDKLFMQAMAKFEGVSLSELIRTKTLEALEDEYDARVADVAWAEYQADLANRIEPMTLEQMAEELGIEL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K2E5U8

Antitoxin

Source ID Structure
AlphaFold DB A0A0K2E5B0

References