Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1864127..1864742 | Replicon | chromosome |
Accession | NZ_CP100430 | ||
Organism | Streptococcus suis strain LSS42 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | NLY76_RS09055 | Protein ID | WP_171841422.1 |
Coordinates | 1864127..1864462 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A075SJ65 |
Locus tag | NLY76_RS09060 | Protein ID | WP_024381089.1 |
Coordinates | 1864455..1864742 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLY76_RS09040 (NLY76_09040) | 1860197..1860970 | - | 774 | WP_044770177.1 | nucleoside phosphorylase | - |
NLY76_RS09045 (NLY76_09045) | 1860985..1861602 | - | 618 | WP_015647409.1 | serine O-acetyltransferase | - |
NLY76_RS09050 (NLY76_09050) | 1861656..1863875 | - | 2220 | WP_044770176.1 | polyribonucleotide nucleotidyltransferase | - |
NLY76_RS09055 (NLY76_09055) | 1864127..1864462 | - | 336 | WP_171841422.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLY76_RS09060 (NLY76_09060) | 1864455..1864742 | - | 288 | WP_024381089.1 | XRE family transcriptional regulator | Antitoxin |
NLY76_RS09065 (NLY76_09065) | 1865062..1865331 | - | 270 | WP_002938849.1 | 30S ribosomal protein S15 | - |
NLY76_RS09070 (NLY76_09070) | 1865536..1866813 | - | 1278 | WP_024401941.1 | solute carrier family 23 protein | - |
NLY76_RS09075 (NLY76_09075) | 1867029..1867505 | - | 477 | WP_044675947.1 | hypothetical protein | - |
NLY76_RS09080 (NLY76_09080) | 1867486..1867704 | - | 219 | WP_044686159.1 | helix-turn-helix transcriptional regulator | - |
NLY76_RS09085 (NLY76_09085) | 1867847..1868356 | - | 510 | WP_044686160.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12818.91 Da Isoelectric Point: 9.5061
>T250550 WP_171841422.1 NZ_CP100430:c1864462-1864127 [Streptococcus suis]
MDKYKVNLPLAIYEELADIRSYIREELKSPDAADKKIQELIAGLRSLEIFPERGFNVDERSKKGPLVPGQLTRGLPIKKD
YIAIYNIDEAQKVVNVRYLVASKSDYMRLFK
MDKYKVNLPLAIYEELADIRSYIREELKSPDAADKKIQELIAGLRSLEIFPERGFNVDERSKKGPLVPGQLTRGLPIKKD
YIAIYNIDEAQKVVNVRYLVASKSDYMRLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|