Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1455666..1456340 | Replicon | chromosome |
| Accession | NZ_CP100430 | ||
| Organism | Streptococcus suis strain LSS42 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | V6Z2K9 |
| Locus tag | NLY76_RS06970 | Protein ID | WP_015647112.1 |
| Coordinates | 1456158..1456340 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A116K2F0 |
| Locus tag | NLY76_RS06965 | Protein ID | WP_015647111.1 |
| Coordinates | 1455666..1456118 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLY76_RS06940 (NLY76_06940) | 1451240..1452406 | - | 1167 | WP_012775254.1 | AI-2E family transporter | - |
| NLY76_RS06945 (NLY76_06945) | 1452542..1453546 | + | 1005 | WP_024414026.1 | lactonase family protein | - |
| NLY76_RS06950 (NLY76_06950) | 1453610..1453795 | + | 186 | WP_024414027.1 | hypothetical protein | - |
| NLY76_RS06955 (NLY76_06955) | 1453823..1454470 | - | 648 | WP_024414028.1 | HAD family hydrolase | - |
| NLY76_RS06960 (NLY76_06960) | 1455343..1455552 | - | 210 | WP_015647110.1 | hypothetical protein | - |
| NLY76_RS06965 (NLY76_06965) | 1455666..1456118 | - | 453 | WP_015647111.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NLY76_RS06970 (NLY76_06970) | 1456158..1456340 | - | 183 | WP_015647112.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NLY76_RS06975 (NLY76_06975) | 1456662..1457078 | - | 417 | WP_024405992.1 | minor capsid protein | - |
| NLY76_RS06980 (NLY76_06980) | 1457080..1457493 | - | 414 | WP_024405993.1 | hypothetical protein | - |
| NLY76_RS06985 (NLY76_06985) | 1457511..1457822 | - | 312 | WP_044758033.1 | hypothetical protein | - |
| NLY76_RS06990 (NLY76_06990) | 1457863..1458258 | - | 396 | WP_027971718.1 | hypothetical protein | - |
| NLY76_RS06995 (NLY76_06995) | 1458305..1458916 | - | 612 | WP_024405995.1 | hypothetical protein | - |
| NLY76_RS07000 (NLY76_07000) | 1459008..1459190 | - | 183 | WP_024405996.1 | hypothetical protein | - |
| NLY76_RS07005 (NLY76_07005) | 1459632..1460459 | - | 828 | WP_024381267.1 | ATP-binding protein | - |
| NLY76_RS07010 (NLY76_07010) | 1460469..1461221 | - | 753 | WP_044758031.1 | DnaD domain protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1453610..1465044 | 11434 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6630.84 Da Isoelectric Point: 10.8207
>T250549 WP_015647112.1 NZ_CP100430:c1456340-1456158 [Streptococcus suis]
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16711.67 Da Isoelectric Point: 3.9495
>AT250549 WP_015647111.1 NZ_CP100430:c1456118-1455666 [Streptococcus suis]
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPTPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPTPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6Z2K9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A116K2F0 |