Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1067319..1067814 Replicon chromosome
Accession NZ_CP100430
Organism Streptococcus suis strain LSS42

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NLY76_RS05140 Protein ID WP_044769866.1
Coordinates 1067548..1067814 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8FDJ1
Locus tag NLY76_RS05135 Protein ID WP_024394016.1
Coordinates 1067319..1067558 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLY76_RS05110 (NLY76_05110) 1062649..1063815 + 1167 WP_044693374.1 carbamoyl phosphate synthase large subunit -
NLY76_RS05115 (NLY76_05115) 1063954..1064094 + 141 WP_032497540.1 hypothetical protein -
NLY76_RS05120 (NLY76_05120) 1064107..1064496 + 390 WP_044677324.1 NisI/SpaI family lantibiotic immunity lipoprotein -
NLY76_RS05125 (NLY76_05125) 1064505..1065257 + 753 WP_024385226.1 ABC transporter ATP-binding protein -
NLY76_RS05130 (NLY76_05130) 1065258..1067228 + 1971 WP_044769864.1 FtsX-like permease family protein -
NLY76_RS05135 (NLY76_05135) 1067319..1067558 + 240 WP_024394016.1 DUF6290 family protein Antitoxin
NLY76_RS05140 (NLY76_05140) 1067548..1067814 + 267 WP_044769866.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NLY76_RS05145 (NLY76_05145) 1067853..1068521 + 669 WP_024381849.1 response regulator transcription factor -
NLY76_RS05150 (NLY76_05150) 1068518..1069459 + 942 WP_015646835.1 sensor histidine kinase -
NLY76_RS05155 (NLY76_05155) 1069536..1071044 + 1509 WP_024390380.1 phosphoglucomutase -
NLY76_RS05160 (NLY76_05160) 1071107..1072177 - 1071 WP_024390379.1 tyrosine recombinase XerS -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1038744..1093597 54853


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-87)

Antitoxin

Protein of unknown function DUF6290

(1-75)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10288.03 Da        Isoelectric Point: 10.4518

>T250548 WP_044769866.1 NZ_CP100430:1067548-1067814 [Streptococcus suis]
MSYKVILSAKAQKQIRKMDKTVASLILRYLYKHIDGCDNPRQYGKALTANRSGQWRYRIGNYRVIVSIEDDKLIVTALEV
GHRKEIYK

Download         Length: 267 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8748.98 Da        Isoelectric Point: 3.7832

>AT250548 WP_024394016.1 NZ_CP100430:1067319-1067558 [Streptococcus suis]
MAAITLKVSEQDKLFMQAMAKFEGVSLSELIRTKTLEALEDEYDARVADIALAEYEADLANGIEPITLEQMAEELGIEL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8FDJ1

References