Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 2802875..2803651 | Replicon | chromosome |
| Accession | NZ_CP100428 | ||
| Organism | Staphylococcus aureus strain RMSA24 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | NLG45_RS14040 | Protein ID | WP_000031108.1 |
| Coordinates | 2803499..2803651 (+) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | NLG45_RS14035 | Protein ID | WP_001251224.1 |
| Coordinates | 2802875..2803474 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLG45_RS14015 (NLG45_14015) | 2798790..2800247 | + | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
| NLG45_RS14020 (NLG45_14020) | 2800240..2800962 | + | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| NLG45_RS14025 (NLG45_14025) | 2801114..2802241 | + | 1128 | WP_254414343.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| NLG45_RS14030 (NLG45_14030) | 2802246..2802716 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| NLG45_RS14035 (NLG45_14035) | 2802875..2803474 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| NLG45_RS14040 (NLG45_14040) | 2803499..2803651 | + | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| NLG45_RS14045 (NLG45_14045) | 2804195..2804590 | + | 396 | WP_000901023.1 | hypothetical protein | - |
| NLG45_RS14050 (NLG45_14050) | 2804786..2806171 | + | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
| NLG45_RS14055 (NLG45_14055) | 2806623..2807444 | - | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T250544 WP_000031108.1 NZ_CP100428:2803499-2803651 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT250544 WP_001251224.1 NZ_CP100428:2802875-2803474 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|