Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2635504..2636033 | Replicon | chromosome |
| Accession | NZ_CP100428 | ||
| Organism | Staphylococcus aureus strain RMSA24 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NLG45_RS13080 | Protein ID | WP_000621175.1 |
| Coordinates | 2635671..2636033 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NLG45_RS13075 | Protein ID | WP_000948331.1 |
| Coordinates | 2635504..2635674 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLG45_RS13045 (NLG45_13045) | 2630540..2631100 | + | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
| NLG45_RS13050 (NLG45_13050) | 2631309..2631788 | + | 480 | WP_001287079.1 | hypothetical protein | - |
| NLG45_RS13055 (NLG45_13055) | 2631781..2633364 | + | 1584 | WP_001294622.1 | PH domain-containing protein | - |
| NLG45_RS13060 (NLG45_13060) | 2633351..2633842 | + | 492 | WP_001205912.1 | PH domain-containing protein | - |
| NLG45_RS13065 (NLG45_13065) | 2633846..2634205 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
| NLG45_RS13070 (NLG45_13070) | 2634271..2635419 | + | 1149 | WP_001281154.1 | alanine racemase | - |
| NLG45_RS13075 (NLG45_13075) | 2635504..2635674 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NLG45_RS13080 (NLG45_13080) | 2635671..2636033 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NLG45_RS13085 (NLG45_13085) | 2636383..2637384 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NLG45_RS13090 (NLG45_13090) | 2637503..2637829 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NLG45_RS13095 (NLG45_13095) | 2637831..2638310 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NLG45_RS13100 (NLG45_13100) | 2638285..2639055 | + | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T250543 WP_000621175.1 NZ_CP100428:2635671-2636033 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|