Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1081873..1082350 Replicon chromosome
Accession NZ_CP100428
Organism Staphylococcus aureus strain RMSA24

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NLG45_RS05355 Protein ID WP_000052076.1
Coordinates 1082162..1082350 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NLG45_RS05350 Protein ID WP_001059690.1
Coordinates 1081873..1082133 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLG45_RS05315 (NLG45_05315) 1077266..1077982 - 717 WP_254414432.1 type I 3-dehydroquinate dehydratase -
NLG45_RS05320 (NLG45_05320) 1078130..1078552 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
NLG45_RS05325 (NLG45_05325) 1078951..1079445 + 495 WP_000569887.1 GNAT family N-acetyltransferase -
NLG45_RS05330 (NLG45_05330) 1079600..1080217 + 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
NLG45_RS05335 (NLG45_05335) 1080290..1080871 - 582 WP_001140697.1 histidine phosphatase family protein -
NLG45_RS05340 (NLG45_05340) 1081096..1081332 + 237 WP_000368687.1 hypothetical protein -
NLG45_RS05345 (NLG45_05345) 1081329..1081532 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NLG45_RS05350 (NLG45_05350) 1081873..1082133 + 261 WP_001059690.1 hypothetical protein Antitoxin
NLG45_RS05355 (NLG45_05355) 1082162..1082350 + 189 WP_000052076.1 hypothetical protein Toxin
NLG45_RS05360 (NLG45_05360) 1082538..1083107 + 570 WP_001106653.1 lipoprotein N-acylation protein LnsA -
NLG45_RS05365 (NLG45_05365) 1083195..1083479 + 285 WP_001004394.1 hypothetical protein -
NLG45_RS05370 (NLG45_05370) 1083541..1083759 + 219 WP_000005884.1 hypothetical protein -
NLG45_RS05375 (NLG45_05375) 1084254..1084454 - 201 WP_254414433.1 cold-shock protein -
NLG45_RS05380 (NLG45_05380) 1084811..1085497 - 687 WP_001548082.1 thermonuclease family protein -
NLG45_RS05385 (NLG45_05385) 1085838..1086308 - 471 WP_000824472.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T250535 WP_000052076.1 NZ_CP100428:1082162-1082350 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT250535 WP_001059690.1 NZ_CP100428:1081873-1082133 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References