Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 1806249..1806885 | Replicon | chromosome |
Accession | NZ_CP100420 | ||
Organism | Niallia sp. RD1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NKG37_RS08570 | Protein ID | WP_169187740.1 |
Coordinates | 1806535..1806885 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R9CA23 |
Locus tag | NKG37_RS08565 | Protein ID | WP_016201247.1 |
Coordinates | 1806249..1806530 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NKG37_RS08545 (NKG37_08545) | 1801717..1802442 | - | 726 | WP_212119571.1 | rhomboid family intramembrane serine protease | - |
NKG37_RS08550 (NKG37_08550) | 1802550..1802900 | + | 351 | WP_254416078.1 | holo-ACP synthase | - |
NKG37_RS08555 (NKG37_08555) | 1803513..1804523 | + | 1011 | WP_254416079.1 | outer membrane lipoprotein carrier protein LolA | - |
NKG37_RS08560 (NKG37_08560) | 1804739..1805896 | + | 1158 | WP_254416080.1 | alanine racemase | - |
NKG37_RS08565 (NKG37_08565) | 1806249..1806530 | + | 282 | WP_016201247.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NKG37_RS08570 (NKG37_08570) | 1806535..1806885 | + | 351 | WP_169187740.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NKG37_RS08575 (NKG37_08575) | 1807727..1808092 | + | 366 | WP_016201244.1 | STAS domain-containing protein | - |
NKG37_RS08580 (NKG37_08580) | 1808096..1808497 | + | 402 | WP_254416081.1 | anti-sigma regulatory factor | - |
NKG37_RS08585 (NKG37_08585) | 1808509..1809519 | + | 1011 | WP_016201242.1 | PP2C family protein-serine/threonine phosphatase | - |
NKG37_RS08590 (NKG37_08590) | 1809575..1809907 | + | 333 | WP_016201241.1 | anti-sigma factor antagonist | - |
NKG37_RS08595 (NKG37_08595) | 1809904..1810374 | + | 471 | WP_016201240.1 | anti-sigma B factor RsbW | - |
NKG37_RS08600 (NKG37_08600) | 1810352..1811149 | + | 798 | WP_016201239.1 | RNA polymerase sigma factor SigB | - |
NKG37_RS08605 (NKG37_08605) | 1811146..1811742 | + | 597 | WP_016201238.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.05 Da Isoelectric Point: 5.1771
>T250532 WP_169187740.1 NZ_CP100420:1806535-1806885 [Niallia sp. RD1]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDEGMMEKVDEALQISLGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDEGMMEKVDEALQISLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|