Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1652664..1653337 | Replicon | chromosome |
| Accession | NZ_CP100418 | ||
| Organism | Streptococcus suis strain STC104 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | G7SGM1 |
| Locus tag | NLY35_RS08290 | Protein ID | WP_014637653.1 |
| Coordinates | 1652664..1652846 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NLY35_RS08295 | Protein ID | WP_201343674.1 |
| Coordinates | 1652885..1653337 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLY35_RS08260 (NLY35_08260) | 1647950..1648222 | + | 273 | WP_226317480.1 | XRE family transcriptional regulator | - |
| NLY35_RS08265 (NLY35_08265) | 1648219..1649085 | + | 867 | WP_201343672.1 | primase alpha helix C-terminal domain-containing protein | - |
| NLY35_RS08270 (NLY35_08270) | 1649145..1650605 | + | 1461 | WP_201343680.1 | DNA primase family protein | - |
| NLY35_RS08275 (NLY35_08275) | 1650941..1651381 | + | 441 | WP_024393720.1 | hypothetical protein | - |
| NLY35_RS08280 (NLY35_08280) | 1651451..1651951 | + | 501 | WP_105157412.1 | hypothetical protein | - |
| NLY35_RS08285 (NLY35_08285) | 1652092..1652478 | + | 387 | WP_201343673.1 | sigma-70 family RNA polymerase sigma factor | - |
| NLY35_RS08290 (NLY35_08290) | 1652664..1652846 | + | 183 | WP_014637653.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NLY35_RS08295 (NLY35_08295) | 1652885..1653337 | + | 453 | WP_201343674.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NLY35_RS08300 (NLY35_08300) | 1653449..1653658 | + | 210 | WP_201343675.1 | hypothetical protein | - |
| NLY35_RS08305 (NLY35_08305) | 1654103..1654897 | - | 795 | WP_024417690.1 | hypothetical protein | - |
| NLY35_RS08310 (NLY35_08310) | 1654899..1655216 | - | 318 | WP_002936711.1 | PadR family transcriptional regulator | - |
| NLY35_RS08315 (NLY35_08315) | 1655213..1655377 | - | 165 | WP_002936715.1 | hypothetical protein | - |
| NLY35_RS08320 (NLY35_08320) | 1655567..1657579 | - | 2013 | WP_002936720.1 | FtsX-like permease family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1637706..1658339 | 20633 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6653.87 Da Isoelectric Point: 10.8207
>T250530 WP_014637653.1 NZ_CP100418:1652664-1652846 [Streptococcus suis]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16671.61 Da Isoelectric Point: 3.9497
>AT250530 WP_201343674.1 NZ_CP100418:1652885-1653337 [Streptococcus suis]
MLVTYPALFYYDDSDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPAPINTLSLANNNPF
RDDEDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDSDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPAPINTLSLANNNPF
RDDEDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|