Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 565196..565679 Replicon chromosome
Accession NZ_CP100418
Organism Streptococcus suis strain STC104

Toxin (Protein)


Gene name relE Uniprot ID A0A0Z8BIZ7
Locus tag NLY35_RS02935 Protein ID WP_009910443.1
Coordinates 565419..565679 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8BIX7
Locus tag NLY35_RS02930 Protein ID WP_012775256.1
Coordinates 565196..565417 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLY35_RS02900 (NLY35_02900) 560203..560838 + 636 WP_024386271.1 phosphoserine phosphatase SerB -
NLY35_RS02905 (NLY35_02905) 560869..561514 - 646 Protein_522 HAD family hydrolase -
NLY35_RS02910 (NLY35_02910) 561622..562749 + 1128 WP_002935718.1 glycerate kinase -
NLY35_RS02915 (NLY35_02915) 562740..562967 + 228 WP_002935708.1 hypothetical protein -
NLY35_RS02920 (NLY35_02920) 562977..563429 - 453 WP_013730449.1 DUF1694 domain-containing protein -
NLY35_RS02925 (NLY35_02925) 563579..564886 + 1308 WP_002935704.1 phosphopyruvate hydratase -
NLY35_RS02930 (NLY35_02930) 565196..565417 + 222 WP_012775256.1 DUF6290 family protein Antitoxin
NLY35_RS02935 (NLY35_02935) 565419..565679 + 261 WP_009910443.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NLY35_RS02940 (NLY35_02940) 565846..566487 + 642 WP_024413325.1 HAD family hydrolase -
NLY35_RS02945 (NLY35_02945) 566520..566705 - 186 WP_002935693.1 hypothetical protein -
NLY35_RS02950 (NLY35_02950) 566769..567773 - 1005 WP_024402853.1 lactonase family protein -
NLY35_RS02955 (NLY35_02955) 567909..569075 + 1167 WP_204101610.1 AI-2E family transporter -
NLY35_RS02960 (NLY35_02960) 569065..570294 + 1230 WP_024417660.1 tetratricopeptide repeat protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10270.78 Da        Isoelectric Point: 9.6925

>T250526 WP_009910443.1 NZ_CP100418:565419-565679 [Streptococcus suis]
MYHLEYSKKAQKQIKKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT250526 WP_012775256.1 NZ_CP100418:565196-565417 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8BIZ7

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8BIX7

References