Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 5560283..5560853 | Replicon | chromosome |
Accession | NZ_CP100397 | ||
Organism | Streptomyces rimosus subsp. rimosus strain HP126 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | L8ERH5 |
Locus tag | SRIMHP_RS24190 | Protein ID | WP_003982453.1 |
Coordinates | 5560506..5560853 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | L8ERT3 |
Locus tag | SRIMHP_RS24185 | Protein ID | WP_003982452.1 |
Coordinates | 5560283..5560519 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SRIMHP_RS24170 (SRIMHP_24265) | 5555705..5556862 | + | 1158 | WP_003982449.1 | allantoicase | - |
SRIMHP_RS24175 (SRIMHP_24270) | 5556934..5559510 | - | 2577 | WP_003982450.1 | aminopeptidase N | - |
SRIMHP_RS24180 (SRIMHP_24275) | 5559644..5560243 | + | 600 | WP_003982451.1 | Uma2 family endonuclease | - |
SRIMHP_RS24185 (SRIMHP_24280) | 5560283..5560519 | + | 237 | WP_003982452.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
SRIMHP_RS24190 (SRIMHP_24285) | 5560506..5560853 | + | 348 | WP_003982453.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
SRIMHP_RS24195 (SRIMHP_24290) | 5560934..5561455 | + | 522 | WP_003982454.1 | DUF1203 domain-containing protein | - |
SRIMHP_RS24200 (SRIMHP_24295) | 5561526..5562557 | - | 1032 | WP_003982455.1 | aspartate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12493.43 Da Isoelectric Point: 10.8691
>T250525 WP_003982453.1 NZ_CP100397:5560506-5560853 [Streptomyces rimosus subsp. rimosus]
MRRGDLYLVDLEPVRGSEANKYRPAVVVSNDAANRSVQRAGRGVVTVVPVTANVARVYPFQVLLTADDCGLPRDSKAQCE
QVRAVSVERLGRRVGSVPARVMVGLDAALRRHLAL
MRRGDLYLVDLEPVRGSEANKYRPAVVVSNDAANRSVQRAGRGVVTVVPVTANVARVYPFQVLLTADDCGLPRDSKAQCE
QVRAVSVERLGRRVGSVPARVMVGLDAALRRHLAL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|