Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 2890428..2890953 | Replicon | chromosome |
| Accession | NZ_CP100397 | ||
| Organism | Streptomyces rimosus subsp. rimosus strain HP126 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | L8EGB8 |
| Locus tag | SRIMHP_RS11890 | Protein ID | WP_003987428.1 |
| Coordinates | 2890690..2890953 (+) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | L8ED57 |
| Locus tag | SRIMHP_RS11885 | Protein ID | WP_003987429.1 |
| Coordinates | 2890428..2890697 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SRIMHP_RS11860 (SRIMHP_11930) | 2885460..2886182 | + | 723 | WP_030181983.1 | PIG-L deacetylase family protein | - |
| SRIMHP_RS11865 (SRIMHP_11935) | 2886170..2887138 | - | 969 | WP_003982326.1 | alpha/beta hydrolase | - |
| SRIMHP_RS11870 (SRIMHP_11940) | 2887268..2887777 | + | 510 | WP_003982327.1 | hypothetical protein | - |
| SRIMHP_RS11875 (SRIMHP_11945) | 2887818..2888402 | + | 585 | WP_003982328.1 | Uma2 family endonuclease | - |
| SRIMHP_RS11880 (SRIMHP_11950) | 2888444..2890124 | - | 1681 | Protein_2360 | IS1182-like element ISSdi1 family transposase | - |
| SRIMHP_RS11885 (SRIMHP_11960) | 2890428..2890697 | + | 270 | WP_003987429.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| SRIMHP_RS11890 (SRIMHP_11965) | 2890690..2890953 | + | 264 | WP_003987428.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| SRIMHP_RS11895 (SRIMHP_11970) | 2891088..2892176 | - | 1089 | WP_003987427.1 | redox-regulated ATPase YchF | - |
| SRIMHP_RS11900 (SRIMHP_11975) | 2892719..2893426 | + | 708 | WP_063604328.1 | hypothetical protein | - |
| SRIMHP_RS11905 (SRIMHP_11980) | 2893392..2894264 | - | 873 | WP_078586864.1 | ROK family protein | - |
| SRIMHP_RS11910 (SRIMHP_11985) | 2894350..2895393 | - | 1044 | WP_078586862.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10084.54 Da Isoelectric Point: 8.5041
>T250524 WP_003987428.1 NZ_CP100397:2890690-2890953 [Streptomyces rimosus subsp. rimosus]
VSEYRTVFRPEAQTELRKVPRDMALRILAKLTELETDPLGFNTTALVSQPDRRRLRVGDYRLIYTIDNGELVVWVVHVGH
RSTVYDA
VSEYRTVFRPEAQTELRKVPRDMALRILAKLTELETDPLGFNTTALVSQPDRRRLRVGDYRLIYTIDNGELVVWVVHVGH
RSTVYDA
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|