Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 20297..20990 | Replicon | plasmid pFAHZZU2447_NDM |
Accession | NZ_CP100393 | ||
Organism | Aeromonas caviae strain FAHZZU2447 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | NJR02_RS21325 | Protein ID | WP_000182276.1 |
Coordinates | 20297..20653 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | NJR02_RS21330 | Protein ID | WP_001172026.1 |
Coordinates | 20655..20990 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NJR02_RS21310 (NJR02_21310) | 15408..16253 | - | 846 | WP_003464995.1 | AraC family transcriptional regulator | - |
NJR02_RS21315 (NJR02_21315) | 16490..19519 | - | 3030 | WP_032432545.1 | Tn3 family transposase | - |
NJR02_RS21320 (NJR02_21320) | 19503..20105 | - | 603 | WP_010465829.1 | recombinase family protein | - |
NJR02_RS21325 (NJR02_21325) | 20297..20653 | + | 357 | WP_000182276.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NJR02_RS21330 (NJR02_21330) | 20655..20990 | + | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NJR02_RS21335 (NJR02_21335) | 21005..21340 | + | 336 | WP_000741275.1 | hypothetical protein | - |
NJR02_RS21340 (NJR02_21340) | 21364..21690 | + | 327 | WP_000091614.1 | hypothetical protein | - |
NJR02_RS21345 (NJR02_21345) | 21687..22067 | + | 381 | WP_001054412.1 | hypothetical protein | - |
NJR02_RS21350 (NJR02_21350) | 22185..23451 | + | 1267 | Protein_28 | HD-GYP domain-containing protein | - |
NJR02_RS21355 (NJR02_21355) | 23735..24013 | + | 279 | WP_010465808.1 | hypothetical protein | - |
NJR02_RS21360 (NJR02_21360) | 24054..24179 | - | 126 | Protein_30 | mercuric transport protein periplasmic component | - |
NJR02_RS21365 (NJR02_21365) | 24193..24543 | - | 351 | WP_001294663.1 | mercuric transport protein MerT | - |
NJR02_RS21370 (NJR02_21370) | 24615..25049 | + | 435 | WP_000429836.1 | Hg(II)-responsive transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1B / aph(6)-Id / aph(3'')-Ib / aac(3)-IId / dfrA5 / qacE / sul1 / blaNDM-1 / blaOXA-427 / mph(A) | - | 1..243752 | 243752 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12912.93 Da Isoelectric Point: 8.9018
>T250523 WP_000182276.1 NZ_CP100393:20297-20653 [Aeromonas caviae]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKELKGFGGAGVLKVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQEL
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKELKGFGGAGVLKVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQEL
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|