Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 2690313..2691230 | Replicon | chromosome |
| Accession | NZ_CP100391 | ||
| Organism | Bacillus velezensis strain PHP1601 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | I2HQ15 |
| Locus tag | NJ242_RS12970 | Protein ID | WP_007407256.1 |
| Coordinates | 2690313..2691059 (+) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | NJ242_RS12975 | Protein ID | WP_003154807.1 |
| Coordinates | 2691060..2691230 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NJ242_RS12950 (NJ242_12950) | 2685706..2686656 | - | 951 | WP_032874618.1 | ring-cleaving dioxygenase | - |
| NJ242_RS12955 (NJ242_12955) | 2686978..2688294 | + | 1317 | WP_032874616.1 | amino acid permease | - |
| NJ242_RS12960 (NJ242_12960) | 2688580..2689197 | + | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
| NJ242_RS12965 (NJ242_12965) | 2689210..2690208 | + | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
| NJ242_RS12970 (NJ242_12970) | 2690313..2691059 | + | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| NJ242_RS12975 (NJ242_12975) | 2691060..2691230 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| NJ242_RS12980 (NJ242_12980) | 2691327..2691452 | + | 126 | WP_003154809.1 | hypothetical protein | - |
| NJ242_RS12985 (NJ242_12985) | 2691487..2692365 | - | 879 | WP_032874609.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NJ242_RS12990 (NJ242_12990) | 2692379..2692642 | - | 264 | WP_003154813.1 | phage holin | - |
| NJ242_RS12995 (NJ242_12995) | 2692656..2692919 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
| NJ242_RS13000 (NJ242_13000) | 2692971..2693732 | - | 762 | WP_032874607.1 | hypothetical protein | - |
| NJ242_RS13005 (NJ242_13005) | 2693789..2693986 | - | 198 | WP_032874605.1 | XkdX family protein | - |
| NJ242_RS13010 (NJ242_13010) | 2693991..2694362 | - | 372 | WP_032874603.1 | XkdW family protein | - |
| NJ242_RS13015 (NJ242_13015) | 2694375..2695997 | - | 1623 | WP_032874601.1 | pyocin knob domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T250520 WP_007407256.1 NZ_CP100391:2690313-2691059 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|