Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2160575..2161323 | Replicon | chromosome |
| Accession | NZ_CP100390 | ||
| Organism | Alkalimarinus sp. A2M4 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | NKI27_RS09760 | Protein ID | WP_265045873.1 |
| Coordinates | 2160575..2161060 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | NKI27_RS09765 | Protein ID | WP_265045874.1 |
| Coordinates | 2161048..2161323 (-) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NKI27_RS09745 (NKI27_09730) | 2156305..2157246 | - | 942 | WP_265045870.1 | SDR family oxidoreductase | - |
| NKI27_RS09750 (NKI27_09735) | 2157246..2158061 | - | 816 | WP_265045871.1 | lysophospholipid acyltransferase family protein | - |
| NKI27_RS09755 (NKI27_09740) | 2158383..2159567 | + | 1185 | WP_265045872.1 | tyrosine-type recombinase/integrase | - |
| NKI27_RS09760 (NKI27_09745) | 2160575..2161060 | - | 486 | WP_265045873.1 | GNAT family N-acetyltransferase | Toxin |
| NKI27_RS09765 (NKI27_09750) | 2161048..2161323 | - | 276 | WP_265045874.1 | DUF1778 domain-containing protein | Antitoxin |
| NKI27_RS09770 (NKI27_09755) | 2161530..2161817 | - | 288 | WP_265045875.1 | hypothetical protein | - |
| NKI27_RS09775 (NKI27_09760) | 2161902..2162657 | - | 756 | WP_265045876.1 | metallophosphoesterase | - |
| NKI27_RS09780 (NKI27_09765) | 2162710..2162901 | - | 192 | WP_265045877.1 | hypothetical protein | - |
| NKI27_RS09785 (NKI27_09770) | 2162974..2163117 | + | 144 | WP_265045878.1 | P-loop NTPase | - |
| NKI27_RS09790 (NKI27_09775) | 2163136..2163528 | + | 393 | WP_265045879.1 | hypothetical protein | - |
| NKI27_RS09795 (NKI27_09780) | 2163607..2163819 | + | 213 | WP_265045880.1 | hypothetical protein | - |
| NKI27_RS09800 (NKI27_09785) | 2163992..2164258 | + | 267 | WP_265045881.1 | hypothetical protein | - |
| NKI27_RS09805 (NKI27_09790) | 2164360..2164716 | + | 357 | WP_265045882.1 | hypothetical protein | - |
| NKI27_RS09810 (NKI27_09795) | 2164771..2165058 | + | 288 | WP_265045883.1 | hypothetical protein | - |
| NKI27_RS09815 (NKI27_09800) | 2165058..2165411 | + | 354 | WP_265045884.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NKI27_RS09820 (NKI27_09805) | 2165404..2165607 | + | 204 | WP_265045885.1 | hypothetical protein | - |
| NKI27_RS09825 (NKI27_09810) | 2165573..2165983 | + | 411 | WP_265045886.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | xcpR / xcpT | 2099354..2482404 | 383050 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 18086.14 Da Isoelectric Point: 9.7903
>T250519 WP_265045873.1 NZ_CP100390:c2161060-2160575 [Alkalimarinus sp. A2M4]
MGRISKPEPLRSVHDLSRFSCGIDSLDQWLKTRALKNERINASRTYVVCDELRVAGYYCLATGSIEHNESPSKVKRNMPS
PIPVMILGRLAVDIDYQDQKIGKGLLKDAVLRTILISEQVGVKAMLVHAINDSARYFYKAHGFIESPFDPMKLLLPTAKK
V
MGRISKPEPLRSVHDLSRFSCGIDSLDQWLKTRALKNERINASRTYVVCDELRVAGYYCLATGSIEHNESPSKVKRNMPS
PIPVMILGRLAVDIDYQDQKIGKGLLKDAVLRTILISEQVGVKAMLVHAINDSARYFYKAHGFIESPFDPMKLLLPTAKK
V
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|