Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 1349655..1350196 | Replicon | chromosome |
Accession | NZ_CP100390 | ||
Organism | Alkalimarinus sp. A2M4 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | NKI27_RS06090 | Protein ID | WP_265048794.1 |
Coordinates | 1349655..1349957 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | NKI27_RS06095 | Protein ID | WP_265048795.1 |
Coordinates | 1349957..1350196 (-) | Length | 80 a.a. |
Genomic Context
Location: 1345174..1345440 (267 bp)
Type: Others
Protein ID: WP_265048786.1
Type: Others
Protein ID: WP_265048786.1
Location: 1345437..1345724 (288 bp)
Type: Others
Protein ID: WP_265048787.1
Type: Others
Protein ID: WP_265048787.1
Location: 1345966..1346490 (525 bp)
Type: Others
Protein ID: WP_265048788.1
Type: Others
Protein ID: WP_265048788.1
Location: 1346612..1347160 (549 bp)
Type: Others
Protein ID: WP_265048789.1
Type: Others
Protein ID: WP_265048789.1
Location: 1347406..1347660 (255 bp)
Type: Others
Protein ID: WP_265048790.1
Type: Others
Protein ID: WP_265048790.1
Location: 1347653..1347916 (264 bp)
Type: Others
Protein ID: WP_265048791.1
Type: Others
Protein ID: WP_265048791.1
Location: 1347980..1348645 (666 bp)
Type: Others
Protein ID: WP_265048792.1
Type: Others
Protein ID: WP_265048792.1
Location: 1348714..1349589 (876 bp)
Type: Others
Protein ID: WP_265048793.1
Type: Others
Protein ID: WP_265048793.1
Location: 1351610..1351927 (318 bp)
Type: Others
Protein ID: WP_265048798.1
Type: Others
Protein ID: WP_265048798.1
Location: 1352207..1352995 (789 bp)
Type: Others
Protein ID: WP_265048799.1
Type: Others
Protein ID: WP_265048799.1
Location: 1349655..1349957 (303 bp)
Type: Toxin
Protein ID: WP_265048794.1
Type: Toxin
Protein ID: WP_265048794.1
Location: 1349957..1350196 (240 bp)
Type: Antitoxin
Protein ID: WP_265048795.1
Type: Antitoxin
Protein ID: WP_265048795.1
Location: 1350297..1350506 (210 bp)
Type: Others
Protein ID: WP_265049474.1
Type: Others
Protein ID: WP_265049474.1
Location: 1350570..1350842 (273 bp)
Type: Others
Protein ID: WP_265048796.1
Type: Others
Protein ID: WP_265048796.1
Location: 1351081..1351362 (282 bp)
Type: Others
Protein ID: WP_265048797.1
Type: Others
Protein ID: WP_265048797.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NKI27_RS06050 (NKI27_06050) | 1345174..1345440 | + | 267 | WP_265048786.1 | transcriptional regulator | - |
NKI27_RS06055 (NKI27_06055) | 1345437..1345724 | + | 288 | WP_265048787.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NKI27_RS06060 (NKI27_06060) | 1345966..1346490 | + | 525 | WP_265048788.1 | HNH endonuclease | - |
NKI27_RS06065 (NKI27_06065) | 1346612..1347160 | + | 549 | WP_265048789.1 | hypothetical protein | - |
NKI27_RS06070 (NKI27_06070) | 1347406..1347660 | + | 255 | WP_265048790.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
NKI27_RS06075 (NKI27_06075) | 1347653..1347916 | + | 264 | WP_265048791.1 | Txe/YoeB family addiction module toxin | - |
NKI27_RS06080 (NKI27_06080) | 1347980..1348645 | + | 666 | WP_265048792.1 | hypothetical protein | - |
NKI27_RS06085 (NKI27_06085) | 1348714..1349589 | + | 876 | WP_265048793.1 | class A beta-lactamase | - |
NKI27_RS06090 (NKI27_06090) | 1349655..1349957 | - | 303 | WP_265048794.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NKI27_RS06095 (NKI27_06095) | 1349957..1350196 | - | 240 | WP_265048795.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
NKI27_RS06100 (NKI27_06100) | 1350297..1350506 | - | 210 | WP_265049474.1 | type II toxin-antitoxin system YafQ family toxin | - |
NKI27_RS06105 (NKI27_06105) | 1350570..1350842 | - | 273 | WP_265048796.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
NKI27_RS06110 (NKI27_06110) | 1351081..1351362 | - | 282 | WP_265048797.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
NKI27_RS06115 (NKI27_06115) | 1351610..1351927 | + | 318 | WP_265048798.1 | hypothetical protein | - |
NKI27_RS06120 (NKI27_06120) | 1352207..1352995 | + | 789 | WP_265048799.1 | transporter substrate-binding domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11825.70 Da Isoelectric Point: 10.5457
>T250516 WP_265048794.1 NZ_CP100390:c1349957-1349655 [Alkalimarinus sp. A2M4]
MGTFTLTTKARADLKSIAIYTQRKWGKEQRKIYIRQFDDTFHMLSKTPRVGTECDYIKTGYRKFPVTSHIVFYRGTSETS
IEIVRILHKNMDARERLVHP
MGTFTLTTKARADLKSIAIYTQRKWGKEQRKIYIRQFDDTFHMLSKTPRVGTECDYIKTGYRKFPVTSHIVFYRGTSETS
IEIVRILHKNMDARERLVHP
Download Length: 303 bp