Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-Phd
Location 1338742..1339298 Replicon chromosome
Accession NZ_CP100390
Organism Alkalimarinus sp. A2M4

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NKI27_RS05970 Protein ID WP_265048772.1
Coordinates 1338987..1339298 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NKI27_RS05965 Protein ID WP_265048771.1
Coordinates 1338742..1338999 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NKI27_RS05945 (NKI27_05945) 1333914..1334660 + 747 WP_265048769.1 N-formylglutamate amidohydrolase -
NKI27_RS05950 (NKI27_05950) 1335445..1337040 - 1596 WP_265048770.1 IS66 family transposase -
NKI27_RS05955 (NKI27_05955) 1337065..1337424 - 360 WP_265048682.1 IS66 family insertion sequence element accessory protein TnpB -
NKI27_RS05960 (NKI27_05960) 1337421..1337732 - 312 WP_265048683.1 hypothetical protein -
NKI27_RS05965 (NKI27_05965) 1338742..1338999 + 258 WP_265048771.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NKI27_RS05970 (NKI27_05970) 1338987..1339298 + 312 WP_265048772.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NKI27_RS05975 (NKI27_05975) 1339365..1339565 + 201 WP_265048773.1 hypothetical protein -
NKI27_RS05980 (NKI27_05980) 1339858..1340106 + 249 WP_265048774.1 hypothetical protein -
NKI27_RS05985 (NKI27_05985) 1340305..1340769 + 465 WP_265048775.1 GFA family protein -
NKI27_RS05990 (NKI27_05990) 1340851..1341258 + 408 WP_265048776.1 lysozyme inhibitor LprI family protein -
NKI27_RS05995 (NKI27_05995) 1341376..1341675 + 300 WP_265048777.1 hypothetical protein -
NKI27_RS06000 (NKI27_06000) 1341722..1341961 + 240 WP_265048778.1 hypothetical protein -
NKI27_RS06005 (NKI27_06005) 1341976..1342269 - 294 WP_265048779.1 hypothetical protein -
NKI27_RS06010 (NKI27_06010) 1342259..1342474 - 216 Protein_1188 transposase domain-containing protein -
NKI27_RS06015 (NKI27_06015) 1342442..1342657 + 216 WP_265049560.1 hypothetical protein -
NKI27_RS06020 (NKI27_06020) 1342768..1343013 - 246 WP_265048780.1 type II toxin-antitoxin system RelE/ParE family toxin -
NKI27_RS06025 (NKI27_06025) 1343003..1343251 - 249 WP_265048781.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NKI27_RS06030 (NKI27_06030) 1343537..1343737 + 201 WP_265048782.1 hypothetical protein -
NKI27_RS06035 (NKI27_06035) 1343833..1344150 - 318 WP_265048783.1 CcdB family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1342259..1342480 221


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-70)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12050.61 Da        Isoelectric Point: 4.5332

>T250513 WP_265048772.1 NZ_CP100390:1338987-1339298 [Alkalimarinus sp. A2M4]
MAQITWTEPALENLNDIAEYIAVSNPYAAKQLVENVFSKVQRLEQFPDSGRVPEEISTLNYREVVVNPCRVFYKVDNDSV
YILHVMRQERDLRKFLLSTENEN

Download         Length: 312 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9752.36 Da        Isoelectric Point: 7.2034

>AT250513 WP_265048771.1 NZ_CP100390:1338742-1338999 [Alkalimarinus sp. A2M4]
MRTEVVTTLKRQATKLLADLHESKEPILITEHGQPSAYLLDVADYELMVDRMKILEGIAKGEQAIRDGRTLGMEQAREKM
NKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References