Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 78232..78765 | Replicon | chromosome |
Accession | NZ_CP100390 | ||
Organism | Alkalimarinus sp. A2M4 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | NKI27_RS00355 | Protein ID | WP_265047716.1 |
Coordinates | 78232..78528 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | NKI27_RS00360 | Protein ID | WP_265047717.1 |
Coordinates | 78529..78765 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NKI27_RS00330 (NKI27_00330) | 73235..74638 | + | 1404 | WP_265047711.1 | MotA/TolQ/ExbB proton channel family protein | - |
NKI27_RS00335 (NKI27_00335) | 74648..75184 | + | 537 | WP_265047712.1 | MotA/TolQ/ExbB proton channel family protein | - |
NKI27_RS00340 (NKI27_00340) | 75218..75628 | + | 411 | WP_265047713.1 | biopolymer transporter ExbD | - |
NKI27_RS00345 (NKI27_00345) | 75637..76359 | + | 723 | WP_265047714.1 | energy transducer TonB | - |
NKI27_RS00350 (NKI27_00350) | 76356..78179 | + | 1824 | WP_265047715.1 | hypothetical protein | - |
NKI27_RS00355 (NKI27_00355) | 78232..78528 | - | 297 | WP_265047716.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NKI27_RS00360 (NKI27_00360) | 78529..78765 | - | 237 | WP_265047717.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
NKI27_RS00365 (NKI27_00365) | 79267..80892 | + | 1626 | WP_265047718.1 | ATP-binding cassette domain-containing protein | - |
NKI27_RS00370 (NKI27_00370) | 81062..81538 | + | 477 | WP_265047719.1 | DUF3124 domain-containing protein | - |
NKI27_RS00375 (NKI27_00375) | 81535..82155 | - | 621 | WP_265047720.1 | MarC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11340.83 Da Isoelectric Point: 4.4612
>T250511 WP_265047716.1 NZ_CP100390:c78528-78232 [Alkalimarinus sp. A2M4]
VSSFRLRPEAESDLETIWLYTEQNWGIEQAHAYIDGMVDIFQLLSNNPLMCPERSEFTPAVRIHHHAYHLVVFVLSDAGI
DVVRILHESMDIDTQLTF
VSSFRLRPEAESDLETIWLYTEQNWGIEQAHAYIDGMVDIFQLLSNNPLMCPERSEFTPAVRIHHHAYHLVVFVLSDAGI
DVVRILHESMDIDTQLTF
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|