Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4717845..4718461 | Replicon | chromosome |
| Accession | NZ_CP100388 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain VKH10 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LZ581_RS22360 | Protein ID | WP_017382676.1 |
| Coordinates | 4717845..4718216 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | LZ581_RS22365 | Protein ID | WP_015569912.1 |
| Coordinates | 4718219..4718461 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ581_RS22345 (LZ581_22345) | 4715345..4716247 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| LZ581_RS22350 (LZ581_22350) | 4716244..4716879 | + | 636 | WP_003861958.1 | formate dehydrogenase cytochrome b556 subunit | - |
| LZ581_RS22355 (LZ581_22355) | 4716876..4717805 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| LZ581_RS22360 (LZ581_22360) | 4717845..4718216 | - | 372 | WP_017382676.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LZ581_RS22365 (LZ581_22365) | 4718219..4718461 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| LZ581_RS22370 (LZ581_22370) | 4718660..4719580 | + | 921 | WP_254309470.1 | alpha/beta hydrolase | - |
| LZ581_RS22375 (LZ581_22375) | 4719589..4720530 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| LZ581_RS22380 (LZ581_22380) | 4720575..4721012 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| LZ581_RS22385 (LZ581_22385) | 4721009..4721890 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| LZ581_RS22390 (LZ581_22390) | 4721884..4722483 | - | 600 | WP_063413088.1 | glucose-1-phosphatase | - |
| LZ581_RS22395 (LZ581_22395) | 4722602..4723402 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13737.88 Da Isoelectric Point: 6.4882
>T250510 WP_017382676.1 NZ_CP100388:c4718216-4717845 [Enterobacter hormaechei subsp. steigerwaltii]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|