Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3926292..3926949 | Replicon | chromosome |
| Accession | NZ_CP100388 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain VKH10 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A179PSF7 |
| Locus tag | LZ581_RS18545 | Protein ID | WP_017382887.1 |
| Coordinates | 3926292..3926702 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | LZ581_RS18550 | Protein ID | WP_003863437.1 |
| Coordinates | 3926683..3926949 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ581_RS18525 (LZ581_18525) | 3922290..3924023 | - | 1734 | WP_126764932.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| LZ581_RS18530 (LZ581_18530) | 3924029..3924742 | - | 714 | WP_023295380.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LZ581_RS18535 (LZ581_18535) | 3924771..3925667 | - | 897 | WP_254309371.1 | site-specific tyrosine recombinase XerD | - |
| LZ581_RS18540 (LZ581_18540) | 3925769..3926290 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| LZ581_RS18545 (LZ581_18545) | 3926292..3926702 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
| LZ581_RS18550 (LZ581_18550) | 3926683..3926949 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| LZ581_RS18555 (LZ581_18555) | 3927244..3928224 | + | 981 | WP_048219529.1 | tRNA-modifying protein YgfZ | - |
| LZ581_RS18560 (LZ581_18560) | 3928336..3928995 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| LZ581_RS18565 (LZ581_18565) | 3929262..3929993 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
| LZ581_RS18570 (LZ581_18570) | 3930110..3931543 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T250508 WP_017382887.1 NZ_CP100388:c3926702-3926292 [Enterobacter hormaechei subsp. steigerwaltii]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A179PSF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |