Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2386251..2386990 | Replicon | chromosome |
| Accession | NZ_CP100388 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain VKH10 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
| Locus tag | LZ581_RS11320 | Protein ID | WP_003857133.1 |
| Coordinates | 2386251..2386736 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | LZ581_RS11325 | Protein ID | WP_003857131.1 |
| Coordinates | 2386724..2386990 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ581_RS11290 (LZ581_11290) | 2381751..2382365 | + | 615 | WP_080337332.1 | NUDIX hydrolase | - |
| LZ581_RS11295 (LZ581_11295) | 2382549..2383184 | - | 636 | WP_015570517.1 | DUF421 domain-containing protein | - |
| LZ581_RS11300 (LZ581_11300) | 2383194..2383640 | - | 447 | WP_014069654.1 | DUF3290 domain-containing protein | - |
| LZ581_RS11305 (LZ581_11305) | 2383957..2384385 | - | 429 | WP_033487951.1 | hypothetical protein | - |
| LZ581_RS11310 (LZ581_11310) | 2384650..2385615 | + | 966 | WP_254309784.1 | hypothetical protein | - |
| LZ581_RS11315 (LZ581_11315) | 2385631..2386200 | + | 570 | WP_032648331.1 | hypothetical protein | - |
| LZ581_RS11320 (LZ581_11320) | 2386251..2386736 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
| LZ581_RS11325 (LZ581_11325) | 2386724..2386990 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| LZ581_RS11330 (LZ581_11330) | 2387054..2387983 | - | 930 | WP_058689393.1 | LysR family transcriptional regulator | - |
| LZ581_RS11335 (LZ581_11335) | 2388113..2389495 | + | 1383 | WP_047741273.1 | MFS transporter | - |
| LZ581_RS11340 (LZ581_11340) | 2389517..2390512 | - | 996 | WP_017382342.1 | DUF2891 domain-containing protein | - |
| LZ581_RS11345 (LZ581_11345) | 2390522..2391508 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2369202..2386990 | 17788 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T250501 WP_003857133.1 NZ_CP100388:c2386736-2386251 [Enterobacter hormaechei subsp. steigerwaltii]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3L9PBP9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |