Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1131334..1131954 Replicon chromosome
Accession NZ_CP100388
Organism Enterobacter hormaechei subsp. steigerwaltii strain VKH10

Toxin (Protein)


Gene name Hha Uniprot ID A0A837FFM2
Locus tag LZ581_RS05355 Protein ID WP_015571250.1
Coordinates 1131334..1131552 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID F5RUW7
Locus tag LZ581_RS05360 Protein ID WP_006809850.1
Coordinates 1131580..1131954 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LZ581_RS05325 (LZ581_05325) 1127346..1127606 + 261 WP_015571255.1 type B 50S ribosomal protein L31 -
LZ581_RS05330 (LZ581_05330) 1127609..1127749 + 141 WP_003859006.1 type B 50S ribosomal protein L36 -
LZ581_RS05335 (LZ581_05335) 1127746..1128456 - 711 WP_058689253.1 GNAT family protein -
LZ581_RS05340 (LZ581_05340) 1128558..1130018 + 1461 WP_254309638.1 PLP-dependent aminotransferase family protein -
LZ581_RS05345 (LZ581_05345) 1129990..1130457 - 468 WP_023296041.1 YlaC family protein -
LZ581_RS05350 (LZ581_05350) 1130574..1131125 - 552 WP_015571251.1 maltose O-acetyltransferase -
LZ581_RS05355 (LZ581_05355) 1131334..1131552 - 219 WP_015571250.1 HHA domain-containing protein Toxin
LZ581_RS05360 (LZ581_05360) 1131580..1131954 - 375 WP_006809850.1 Hha toxicity modulator TomB Antitoxin
LZ581_RS05365 (LZ581_05365) 1132465..1135611 - 3147 WP_015571248.1 multidrug efflux RND transporter permease subunit AcrB -
LZ581_RS05370 (LZ581_05370) 1135634..1136827 - 1194 WP_017694395.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8583.95 Da        Isoelectric Point: 8.9008

>T250498 WP_015571250.1 NZ_CP100388:c1131552-1131334 [Enterobacter hormaechei subsp. steigerwaltii]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14497.28 Da        Isoelectric Point: 4.8989

>AT250498 WP_006809850.1 NZ_CP100388:c1131954-1131580 [Enterobacter hormaechei subsp. steigerwaltii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837FFM2

Antitoxin

Source ID Structure
AlphaFold DB A0A837FGN8

References