Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 3614427..3614980 | Replicon | chromosome |
Accession | NZ_CP100360 | ||
Organism | Halomonas sp. 3H |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NFC98_RS16675 | Protein ID | WP_254276019.1 |
Coordinates | 3614657..3614980 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NFC98_RS16670 | Protein ID | WP_254276018.1 |
Coordinates | 3614427..3614660 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFC98_RS16640 | 3609991..3611052 | + | 1062 | WP_254276012.1 | C45 family peptidase | - |
NFC98_RS16645 | 3611136..3611507 | + | 372 | WP_254276013.1 | hypothetical protein | - |
NFC98_RS16650 | 3611584..3612171 | - | 588 | WP_254276014.1 | DUF4202 domain-containing protein | - |
NFC98_RS16655 | 3612294..3612614 | + | 321 | WP_254276015.1 | antibiotic biosynthesis monooxygenase | - |
NFC98_RS16660 | 3612747..3613145 | - | 399 | WP_254276016.1 | DUF4168 domain-containing protein | - |
NFC98_RS16665 | 3613302..3614108 | - | 807 | WP_254276017.1 | hypothetical protein | - |
NFC98_RS16670 | 3614427..3614660 | + | 234 | WP_254276018.1 | antitoxin MazE family protein | Antitoxin |
NFC98_RS16675 | 3614657..3614980 | + | 324 | WP_254276019.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NFC98_RS16680 | 3615766..3616278 | + | 513 | WP_254276020.1 | WYL domain-containing protein | - |
NFC98_RS16685 | 3616265..3617491 | - | 1227 | WP_254276021.1 | YbfB/YjiJ family MFS transporter | - |
NFC98_RS16690 | 3617726..3618322 | + | 597 | WP_254276022.1 | class I SAM-dependent methyltransferase | - |
NFC98_RS16695 | 3618337..3619341 | + | 1005 | WP_254276023.1 | aldo/keto reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11597.40 Da Isoelectric Point: 8.9139
>T250496 WP_254276019.1 NZ_CP100360:3614657-3614980 [Halomonas sp. 3H]
MRRGDLVTIALSGDFGKPRPALIIQSDQFAGTGSVTVLLLSSTRVDAPLIRLDVESTPENGLQRRSQIMVDKPMTVKRER
VGEAFGHLDDSTMVAVNRALAVFLGFA
MRRGDLVTIALSGDFGKPRPALIIQSDQFAGTGSVTVLLLSSTRVDAPLIRLDVESTPENGLQRRSQIMVDKPMTVKRER
VGEAFGHLDDSTMVAVNRALAVFLGFA
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|