Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-parD/RelE-RHH |
Location | 3516757..3517267 | Replicon | chromosome |
Accession | NZ_CP100351 | ||
Organism | Desulfomicrobium sp. ZS1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NLA06_RS15765 | Protein ID | WP_256479470.1 |
Coordinates | 3516989..3517267 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | NLA06_RS15760 | Protein ID | WP_254078817.1 |
Coordinates | 3516757..3517002 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLA06_RS15740 (NLA06_15740) | 3513275..3514366 | - | 1092 | WP_254078815.1 | tetraacyldisaccharide 4'-kinase | - |
NLA06_RS15745 (NLA06_15745) | 3514413..3515117 | - | 705 | WP_015775326.1 | Bax inhibitor-1/YccA family protein | - |
NLA06_RS15750 (NLA06_15750) | 3515650..3515751 | + | 102 | Protein_3084 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
NLA06_RS15755 (NLA06_15755) | 3516286..3516531 | + | 246 | WP_254078816.1 | CopG family ribbon-helix-helix protein | - |
NLA06_RS15760 (NLA06_15760) | 3516757..3517002 | + | 246 | WP_254078817.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NLA06_RS15765 (NLA06_15765) | 3516989..3517267 | + | 279 | WP_256479470.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLA06_RS15770 (NLA06_15770) | 3517302..3518285 | - | 984 | WP_254078818.1 | transposase | - |
NLA06_RS15775 (NLA06_15775) | 3518411..3518689 | + | 279 | WP_254078819.1 | DUF1778 domain-containing protein | - |
NLA06_RS15780 (NLA06_15780) | 3518689..3519186 | + | 498 | WP_254078820.1 | GNAT family N-acetyltransferase | - |
NLA06_RS15785 (NLA06_15785) | 3519235..3521637 | + | 2403 | WP_254078821.1 | acetate--CoA ligase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10921.74 Da Isoelectric Point: 10.7019
>T250494 WP_256479470.1 NZ_CP100351:3516989-3517267 [Desulfomicrobium sp. ZS1]
MSLTKVRWARNAIKDLERIRIFLEETADSEVMLFEAQRIWESCQRLRQFPESGRPGRIAFTREVVVSPYVIPYRVKKSVV
EILNIFHSAQKR
MSLTKVRWARNAIKDLERIRIFLEETADSEVMLFEAQRIWESCQRLRQFPESGRPGRIAFTREVVVSPYVIPYRVKKSVV
EILNIFHSAQKR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|