Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2889267..2889904 | Replicon | chromosome |
Accession | NZ_CP100351 | ||
Organism | Desulfomicrobium sp. ZS1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NLA06_RS12835 | Protein ID | WP_254078315.1 |
Coordinates | 2889503..2889904 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NLA06_RS12830 | Protein ID | WP_254078314.1 |
Coordinates | 2889267..2889500 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLA06_RS12820 (NLA06_12820) | 2885331..2886743 | - | 1413 | WP_254078312.1 | sugar transferase | - |
NLA06_RS12825 (NLA06_12825) | 2886753..2888312 | - | 1560 | WP_254078313.1 | VPLPA-CTERM-specific exosortase XrtD | - |
NLA06_RS12830 (NLA06_12830) | 2889267..2889500 | + | 234 | WP_254078314.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NLA06_RS12835 (NLA06_12835) | 2889503..2889904 | + | 402 | WP_254078315.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NLA06_RS12840 (NLA06_12840) | 2890019..2891161 | - | 1143 | WP_254078316.1 | AAA family ATPase | - |
NLA06_RS12845 (NLA06_12845) | 2891244..2892122 | - | 879 | WP_254078317.1 | capsular biosynthesis protein | - |
NLA06_RS12850 (NLA06_12850) | 2892238..2893965 | - | 1728 | WP_254078318.1 | Wzz/FepE/Etk N-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14904.14 Da Isoelectric Point: 6.8812
>T250493 WP_254078315.1 NZ_CP100351:2889503-2889904 [Desulfomicrobium sp. ZS1]
MLKYLLDTNIVIYVIKNRPLSVLKTFNQNHGRMAISSITLAELAHGVEKSADPARNLTVVEDFVSRLEVLPYDERAAWQY
GLIRAALERQGTPIGVNDLHIAGHARSLGLVIVTNNLREFERVPGVSVENWVE
MLKYLLDTNIVIYVIKNRPLSVLKTFNQNHGRMAISSITLAELAHGVEKSADPARNLTVVEDFVSRLEVLPYDERAAWQY
GLIRAALERQGTPIGVNDLHIAGHARSLGLVIVTNNLREFERVPGVSVENWVE
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|