Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ParE-CopA/RHH(antitoxin) |
Location | 2880105..2880676 | Replicon | chromosome |
Accession | NZ_CP100351 | ||
Organism | Desulfomicrobium sp. ZS1 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | NLA06_RS12795 | Protein ID | WP_254078308.1 |
Coordinates | 2880386..2880676 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | copA | Uniprot ID | C7LSA4 |
Locus tag | NLA06_RS12790 | Protein ID | WP_015774741.1 |
Coordinates | 2880105..2880398 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLA06_RS12765 (NLA06_12765) | 2875627..2876637 | - | 1011 | WP_254078303.1 | GDP-L-fucose synthase | - |
NLA06_RS12770 (NLA06_12770) | 2876851..2877939 | - | 1089 | WP_254078304.1 | GDP-mannose 4,6-dehydratase | - |
NLA06_RS12775 (NLA06_12775) | 2878411..2878779 | - | 369 | WP_254078305.1 | four helix bundle protein | - |
NLA06_RS12780 (NLA06_12780) | 2879272..2879550 | + | 279 | WP_254078306.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NLA06_RS12785 (NLA06_12785) | 2879559..2879888 | + | 330 | WP_254078307.1 | HigA family addiction module antitoxin | - |
NLA06_RS12790 (NLA06_12790) | 2880105..2880398 | + | 294 | WP_015774741.1 | CopG family transcriptional regulator | Antitoxin |
NLA06_RS12795 (NLA06_12795) | 2880386..2880676 | + | 291 | WP_254078308.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLA06_RS17475 | 2880945..2881391 | - | 447 | WP_256479201.1 | PilZ domain-containing protein | - |
NLA06_RS12805 (NLA06_12805) | 2881570..2881728 | - | 159 | WP_015774744.1 | hypothetical protein | - |
NLA06_RS12810 (NLA06_12810) | 2882014..2882568 | - | 555 | WP_254078310.1 | hypothetical protein | - |
NLA06_RS12815 (NLA06_12815) | 2882948..2885314 | - | 2367 | WP_254078311.1 | tetratricopeptide repeat protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10643.25 Da Isoelectric Point: 6.7089
>T250492 WP_254078308.1 NZ_CP100351:2880386-2880676 [Desulfomicrobium sp. ZS1]
MPRLIWTAGAVDGLGKIHRFLAEKDAQAAAKALDAIRKGANILRYFPQAGRPTEDLEPEHRELLIPFGASGYAVFYETID
DCICILTVKHQKEAGY
MPRLIWTAGAVDGLGKIHRFLAEKDAQAAAKALDAIRKGANILRYFPQAGRPTEDLEPEHRELLIPFGASGYAVFYETID
DCICILTVKHQKEAGY
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|