Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
Location | 1352979..1353757 | Replicon | chromosome |
Accession | NZ_CP100351 | ||
Organism | Desulfomicrobium sp. ZS1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | NLA06_RS06130 | Protein ID | WP_254080223.1 |
Coordinates | 1352979..1353485 (-) | Length | 169 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | NLA06_RS06135 | Protein ID | WP_254080224.1 |
Coordinates | 1353482..1353757 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLA06_RS06090 (NLA06_06090) | 1348926..1349684 | + | 759 | WP_254078279.1 | IS21-like element helper ATPase IstB | - |
NLA06_RS06095 (NLA06_06095) | 1349943..1350407 | - | 465 | WP_254080216.1 | helix-turn-helix transcriptional regulator | - |
NLA06_RS06100 (NLA06_06100) | 1350485..1350700 | + | 216 | WP_254080217.1 | hypothetical protein | - |
NLA06_RS06105 (NLA06_06105) | 1350697..1350960 | + | 264 | WP_254080218.1 | hypothetical protein | - |
NLA06_RS06110 (NLA06_06110) | 1351118..1351405 | + | 288 | WP_254080219.1 | hypothetical protein | - |
NLA06_RS06115 (NLA06_06115) | 1351468..1351617 | + | 150 | WP_254080220.1 | hypothetical protein | - |
NLA06_RS06120 (NLA06_06120) | 1351741..1351989 | + | 249 | WP_254080221.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
NLA06_RS06125 (NLA06_06125) | 1351986..1352363 | + | 378 | WP_254080222.1 | type II toxin-antitoxin system VapC family toxin | - |
NLA06_RS06130 (NLA06_06130) | 1352979..1353485 | - | 507 | WP_254080223.1 | GNAT family N-acetyltransferase | Toxin |
NLA06_RS06135 (NLA06_06135) | 1353482..1353757 | - | 276 | WP_254080224.1 | DUF1778 domain-containing protein | Antitoxin |
NLA06_RS06140 (NLA06_06140) | 1353873..1355390 | - | 1518 | WP_254080225.1 | B12-binding domain-containing radical SAM protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 18169.97 Da Isoelectric Point: 9.5628
>T250489 WP_254080223.1 NZ_CP100351:c1353485-1352979 [Desulfomicrobium sp. ZS1]
VTESFSAPTPLTASHDVSSFSCAEPSLGDWLRHRAMKNQGSGATRTYVVCFGNTVVGYYSLAVGSIEHRFVAGSIKRNMP
EPIPVMILARLAVDRRYAGQCIGTGMLRDALLRTLQAAEIAGIRAMLVHALSEQAASFYRRRGFTASPFDPLVLFLALDH
VGIRLAGS
VTESFSAPTPLTASHDVSSFSCAEPSLGDWLRHRAMKNQGSGATRTYVVCFGNTVVGYYSLAVGSIEHRFVAGSIKRNMP
EPIPVMILARLAVDRRYAGQCIGTGMLRDALLRTLQAAEIAGIRAMLVHALSEQAASFYRRRGFTASPFDPLVLFLALDH
VGIRLAGS
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|