Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 542262..542883 | Replicon | chromosome |
Accession | NZ_CP100351 | ||
Organism | Desulfomicrobium sp. ZS1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NLA06_RS02400 | Protein ID | WP_254079537.1 |
Coordinates | 542539..542883 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NLA06_RS02395 | Protein ID | WP_254079536.1 |
Coordinates | 542262..542555 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLA06_RS02385 (NLA06_02385) | 537913..540234 | + | 2322 | WP_254079534.1 | diguanylate cyclase | - |
NLA06_RS02390 (NLA06_02390) | 540206..541933 | + | 1728 | WP_254079535.1 | sensor domain-containing diguanylate cyclase | - |
NLA06_RS02395 (NLA06_02395) | 542262..542555 | - | 294 | WP_254079536.1 | putative addiction module antidote protein | Antitoxin |
NLA06_RS02400 (NLA06_02400) | 542539..542883 | - | 345 | WP_254079537.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLA06_RS02405 (NLA06_02405) | 543121..544224 | + | 1104 | WP_254079538.1 | ATP-dependent 6-phosphofructokinase | - |
NLA06_RS02410 (NLA06_02410) | 544303..545586 | - | 1284 | WP_254079539.1 | 4Fe-4S binding protein | - |
NLA06_RS02415 (NLA06_02415) | 545762..546616 | + | 855 | WP_256479893.1 | TIGR02285 family protein | - |
NLA06_RS02420 (NLA06_02420) | 546628..547593 | - | 966 | WP_254079541.1 | zinc metalloprotease HtpX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13368.25 Da Isoelectric Point: 9.8503
>T250488 WP_254079537.1 NZ_CP100351:c542883-542539 [Desulfomicrobium sp. ZS1]
MYPNRYNLFISTFHQTDVFSCWLKNIKDIKTRARIVARIRSAEHGNLGDCTPVGEGVSEMRLHFGPGYRLYFWQEGGQVY
WLLAGGEKSTQKRDIERSKKLRYEIEEITHGKNK
MYPNRYNLFISTFHQTDVFSCWLKNIKDIKTRARIVARIRSAEHGNLGDCTPVGEGVSEMRLHFGPGYRLYFWQEGGQVY
WLLAGGEKSTQKRDIERSKKLRYEIEEITHGKNK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|