Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 2227254..2227831 | Replicon | chromosome |
Accession | NZ_CP100350 | ||
Organism | Gilvimarinus sp. DA14 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NHM04_RS09745 | Protein ID | WP_254263601.1 |
Coordinates | 2227254..2227553 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NHM04_RS09750 | Protein ID | WP_254263602.1 |
Coordinates | 2227550..2227831 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHM04_RS09725 (NHM04_09725) | 2223203..2225206 | + | 2004 | WP_254263597.1 | protein-disulfide reductase DsbD family protein | - |
NHM04_RS09730 (NHM04_09730) | 2225206..2225811 | + | 606 | WP_254263598.1 | thioredoxin family protein | - |
NHM04_RS09735 (NHM04_09735) | 2225897..2226487 | + | 591 | WP_254263599.1 | DUF938 domain-containing protein | - |
NHM04_RS09740 (NHM04_09740) | 2226484..2226900 | + | 417 | WP_254263600.1 | MAPEG family protein | - |
NHM04_RS09745 (NHM04_09745) | 2227254..2227553 | - | 300 | WP_254263601.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NHM04_RS09750 (NHM04_09750) | 2227550..2227831 | - | 282 | WP_254263602.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NHM04_RS09755 (NHM04_09755) | 2228106..2229503 | + | 1398 | WP_254263603.1 | methyl-accepting chemotaxis protein | - |
NHM04_RS09760 (NHM04_09760) | 2229963..2230625 | - | 663 | WP_254263604.1 | hypothetical protein | - |
NHM04_RS09765 (NHM04_09765) | 2230625..2231500 | - | 876 | WP_254263605.1 | nucleotidyltransferase | - |
NHM04_RS09770 (NHM04_09770) | 2231579..2232355 | - | 777 | WP_254263606.1 | toll/interleukin-1 receptor domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11341.93 Da Isoelectric Point: 4.5498
>T250487 WP_254263601.1 NZ_CP100350:c2227553-2227254 [Gilvimarinus sp. DA14]
MKVVWSPLALERVEDIARYIAEDKPDAAVEWVEGLFNTVERLSDFPQSGRVVPEVGGRRIREVMFGAYRIIYSVSDQIDI
LTVRRSSQLLRMSELGDEN
MKVVWSPLALERVEDIARYIAEDKPDAAVEWVEGLFNTVERLSDFPQSGRVVPEVGGRRIREVMFGAYRIIYSVSDQIDI
LTVRRSSQLLRMSELGDEN
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|