Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-couple_hipB |
| Location | 1287041..1288284 | Replicon | chromosome |
| Accession | NZ_CP100338 | ||
| Organism | Streptococcus suis strain STC80 | ||
Toxin (Protein)
| Gene name | sezT | Uniprot ID | G7SEB4 |
| Locus tag | NKZ64_RS06415 | Protein ID | WP_001235242.1 |
| Coordinates | 1287041..1287808 (-) | Length | 256 a.a. |
Antitoxin (Protein)
| Gene name | sezA | Uniprot ID | - |
| Locus tag | NKZ64_RS06420 | Protein ID | WP_000578719.1 |
| Coordinates | 1287808..1288284 (-) | Length | 159 a.a. |
Genomic Context
Location: 1292234..1293130 (897 bp)
Type: Others
Protein ID: WP_001809760.1
Type: Others
Protein ID: WP_001809760.1
Location: 1283429..1283794 (366 bp)
Type: Others
Protein ID: WP_000431640.1
Type: Others
Protein ID: WP_000431640.1
Location: 1283797..1284159 (363 bp)
Type: Others
Protein ID: WP_000140674.1
Type: Others
Protein ID: WP_000140674.1
Location: 1284497..1287040 (2544 bp)
Type: Others
Protein ID: WP_000601012.1
Type: Others
Protein ID: WP_000601012.1
Location: 1287041..1287808 (768 bp)
Type: Toxin
Protein ID: WP_001235242.1
Type: Toxin
Protein ID: WP_001235242.1
Location: 1287808..1288284 (477 bp)
Type: Antitoxin
Protein ID: WP_000578719.1
Type: Antitoxin
Protein ID: WP_000578719.1
Location: 1288354..1288644 (291 bp)
Type: Others
Protein ID: WP_000667951.1
Type: Others
Protein ID: WP_000667951.1
Location: 1288695..1289084 (390 bp)
Type: Others
Protein ID: WP_000048066.1
Type: Others
Protein ID: WP_000048066.1
Location: 1289081..1289308 (228 bp)
Type: Others
Protein ID: WP_000110922.1
Type: Others
Protein ID: WP_000110922.1
Location: 1289336..1290436 (1101 bp)
Type: Others
Protein ID: WP_000196860.1
Type: Others
Protein ID: WP_000196860.1
Location: 1290500..1292143 (1644 bp)
Type: Others
Protein ID: WP_004607528.1
Type: Others
Protein ID: WP_004607528.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NKZ64_RS06400 (NKZ64_06400) | 1283429..1283794 | - | 366 | WP_000431640.1 | MobC family plasmid mobilization relaxosome protein | - |
| NKZ64_RS06405 (NKZ64_06405) | 1283797..1284159 | - | 363 | WP_000140674.1 | SAG1252 family conjugative relaxosome accessory protein | - |
| NKZ64_RS06410 (NKZ64_06410) | 1284497..1287040 | - | 2544 | WP_000601012.1 | AAA family ATPase | - |
| NKZ64_RS06415 (NKZ64_06415) | 1287041..1287808 | - | 768 | WP_001235242.1 | type II toxin-antitoxin system toxin PezT | Toxin |
| NKZ64_RS06420 (NKZ64_06420) | 1287808..1288284 | - | 477 | WP_000578719.1 | type II toxin-antitoxin system antitoxin PezA | Antitoxin |
| NKZ64_RS06425 (NKZ64_06425) | 1288354..1288644 | - | 291 | WP_000667951.1 | hypothetical protein | - |
| NKZ64_RS06430 (NKZ64_06430) | 1288695..1289084 | - | 390 | WP_000048066.1 | DUF5945 family protein | - |
| NKZ64_RS06435 (NKZ64_06435) | 1289081..1289308 | - | 228 | WP_000110922.1 | DUF5965 family protein | - |
| NKZ64_RS06440 (NKZ64_06440) | 1289336..1290436 | - | 1101 | WP_000196860.1 | toprim domain-containing protein | - |
| NKZ64_RS06445 (NKZ64_06445) | 1290500..1292143 | - | 1644 | WP_004607528.1 | recombinase family protein | - |
| NKZ64_RS06450 (NKZ64_06450) | 1292234..1293130 | + | 897 | WP_001809760.1 | ParA family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | erm(B) / tet(O) | - | 1271974..1304074 | 32100 | |
| - | inside | Genomic island | erm(B) / tet(O) | - | 1274233..1304074 | 29841 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 256 a.a. Molecular weight: 28985.80 Da Isoelectric Point: 5.1126
>T250477 WP_001235242.1 NZ_CP100338:c1287808-1287041 [Streptococcus suis]
MRLEEFSEAEFQKALQRTIRALTRGKTIPDQPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSQHPNYLALQE
KYGKDSVDYTKGFAGKMVEQLVDELSTQGYHLLIEGTLRTTQVPRQTAQLLSSKGYQVSLAVIGTKPELSYLSTLIRYEE
LYAIDPTQARATPKEHHDGIVENLVDNLRELESENLFDQIQIYQRDRTCIYDSETAEGSAAEVLQECLFGKWSKVEEEMV
KESELLLKELLEKNK
MRLEEFSEAEFQKALQRTIRALTRGKTIPDQPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSQHPNYLALQE
KYGKDSVDYTKGFAGKMVEQLVDELSTQGYHLLIEGTLRTTQVPRQTAQLLSSKGYQVSLAVIGTKPELSYLSTLIRYEE
LYAIDPTQARATPKEHHDGIVENLVDNLRELESENLFDQIQIYQRDRTCIYDSETAEGSAAEVLQECLFGKWSKVEEEMV
KESELLLKELLEKNK
Download Length: 768 bp
Antitoxin
Download Length: 159 a.a. Molecular weight: 18266.77 Da Isoelectric Point: 4.6424
>AT250477 WP_000578719.1 NZ_CP100338:c1288284-1287808 [Streptococcus suis]
MIGDNIKSLRRTHDLTQPEFAKMVGISRNSLSRYENGTSTVSTELIDRICQKFNVSYVDIVGEDKMLTPVEDYHLTLKVE
VIKERGAAILSKLYRYQDSQDIVFDDESNPWILMSDDLAELINTKIYLVATFDEIERYNGYLDGIERMLDMVHHRVVA
MIGDNIKSLRRTHDLTQPEFAKMVGISRNSLSRYENGTSTVSTELIDRICQKFNVSYVDIVGEDKMLTPVEDYHLTLKVE
VIKERGAAILSKLYRYQDSQDIVFDDESNPWILMSDDLAELINTKIYLVATFDEIERYNGYLDGIERMLDMVHHRVVA
Download Length: 477 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G7SEB4 |
Antitoxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| No matching records found | ||