Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 562891..563374 Replicon chromosome
Accession NZ_CP100336
Organism Streptococcus suis strain STC81

Toxin (Protein)


Gene name relE Uniprot ID A0A0Z8BIZ7
Locus tag NKZ66_RS02925 Protein ID WP_009910443.1
Coordinates 563114..563374 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8BIX7
Locus tag NKZ66_RS02920 Protein ID WP_012775256.1
Coordinates 562891..563112 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NKZ66_RS02890 (NKZ66_02890) 557898..558533 + 636 WP_024386271.1 phosphoserine phosphatase SerB -
NKZ66_RS02895 (NKZ66_02895) 558564..559209 - 646 Protein_520 HAD family hydrolase -
NKZ66_RS02900 (NKZ66_02900) 559317..560444 + 1128 WP_002935718.1 glycerate kinase -
NKZ66_RS02905 (NKZ66_02905) 560435..560662 + 228 WP_002935708.1 hypothetical protein -
NKZ66_RS02910 (NKZ66_02910) 560672..561124 - 453 WP_013730449.1 DUF1694 domain-containing protein -
NKZ66_RS02915 (NKZ66_02915) 561274..562581 + 1308 WP_002935704.1 phosphopyruvate hydratase -
NKZ66_RS02920 (NKZ66_02920) 562891..563112 + 222 WP_012775256.1 DUF6290 family protein Antitoxin
NKZ66_RS02925 (NKZ66_02925) 563114..563374 + 261 WP_009910443.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NKZ66_RS02930 (NKZ66_02930) 563541..564182 + 642 WP_024413325.1 HAD family hydrolase -
NKZ66_RS02935 (NKZ66_02935) 564215..564400 - 186 WP_002935693.1 hypothetical protein -
NKZ66_RS02940 (NKZ66_02940) 564464..565468 - 1005 WP_024402853.1 lactonase family protein -
NKZ66_RS02945 (NKZ66_02945) 565604..566770 + 1167 WP_204101610.1 AI-2E family transporter -
NKZ66_RS02950 (NKZ66_02950) 566760..567989 + 1230 WP_024417660.1 tetratricopeptide repeat protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10270.78 Da        Isoelectric Point: 9.6925

>T250469 WP_009910443.1 NZ_CP100336:563114-563374 [Streptococcus suis]
MYHLEYSKKAQKQIKKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT250469 WP_012775256.1 NZ_CP100336:562891-563112 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8BIZ7

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8BIX7

References