Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1650402..1651075 | Replicon | chromosome |
| Accession | NZ_CP100328 | ||
| Organism | Streptococcus suis strain STC86 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | G7SGM1 |
| Locus tag | NKZ81_RS08275 | Protein ID | WP_014637653.1 |
| Coordinates | 1650402..1650584 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NKZ81_RS08280 | Protein ID | WP_201343674.1 |
| Coordinates | 1650623..1651075 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NKZ81_RS08245 (NKZ81_08245) | 1645688..1645960 | + | 273 | WP_226317480.1 | XRE family transcriptional regulator | - |
| NKZ81_RS08250 (NKZ81_08250) | 1645957..1646823 | + | 867 | WP_201343672.1 | primase alpha helix C-terminal domain-containing protein | - |
| NKZ81_RS08255 (NKZ81_08255) | 1646883..1648343 | + | 1461 | WP_201343680.1 | DNA primase family protein | - |
| NKZ81_RS08260 (NKZ81_08260) | 1648679..1649119 | + | 441 | WP_024393720.1 | hypothetical protein | - |
| NKZ81_RS08265 (NKZ81_08265) | 1649189..1649689 | + | 501 | WP_105157412.1 | hypothetical protein | - |
| NKZ81_RS08270 (NKZ81_08270) | 1649830..1650216 | + | 387 | WP_201343673.1 | sigma-70 family RNA polymerase sigma factor | - |
| NKZ81_RS08275 (NKZ81_08275) | 1650402..1650584 | + | 183 | WP_014637653.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NKZ81_RS08280 (NKZ81_08280) | 1650623..1651075 | + | 453 | WP_201343674.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NKZ81_RS08285 (NKZ81_08285) | 1651187..1651396 | + | 210 | WP_201343675.1 | hypothetical protein | - |
| NKZ81_RS08290 (NKZ81_08290) | 1651841..1652635 | - | 795 | WP_024417690.1 | hypothetical protein | - |
| NKZ81_RS08295 (NKZ81_08295) | 1652637..1652954 | - | 318 | WP_002936711.1 | PadR family transcriptional regulator | - |
| NKZ81_RS08300 (NKZ81_08300) | 1652951..1653115 | - | 165 | WP_002936715.1 | hypothetical protein | - |
| NKZ81_RS08305 (NKZ81_08305) | 1653305..1655317 | - | 2013 | WP_002936720.1 | FtsX-like permease family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1635444..1659182 | 23738 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6653.87 Da Isoelectric Point: 10.8207
>T250449 WP_014637653.1 NZ_CP100328:1650402-1650584 [Streptococcus suis]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16671.61 Da Isoelectric Point: 3.9497
>AT250449 WP_201343674.1 NZ_CP100328:1650623-1651075 [Streptococcus suis]
MLVTYPALFYYDDSDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPAPINTLSLANNNPF
RDDEDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDSDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPAPINTLSLANNNPF
RDDEDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|