Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1652670..1653343 | Replicon | chromosome |
| Accession | NZ_CP100326 | ||
| Organism | Streptococcus suis strain STC90 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | G7SGM1 |
| Locus tag | NKZ63_RS08290 | Protein ID | WP_014637653.1 |
| Coordinates | 1652670..1652852 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NKZ63_RS08295 | Protein ID | WP_201343674.1 |
| Coordinates | 1652891..1653343 (+) | Length | 151 a.a. |
Genomic Context
Location: 1647956..1648228 (273 bp)
Type: Others
Protein ID: WP_226317480.1
Type: Others
Protein ID: WP_226317480.1
Location: 1648225..1649091 (867 bp)
Type: Others
Protein ID: WP_201343672.1
Type: Others
Protein ID: WP_201343672.1
Location: 1649151..1650611 (1461 bp)
Type: Others
Protein ID: WP_201343680.1
Type: Others
Protein ID: WP_201343680.1
Location: 1650947..1651387 (441 bp)
Type: Others
Protein ID: WP_024393720.1
Type: Others
Protein ID: WP_024393720.1
Location: 1651457..1651957 (501 bp)
Type: Others
Protein ID: WP_105157412.1
Type: Others
Protein ID: WP_105157412.1
Location: 1652098..1652484 (387 bp)
Type: Others
Protein ID: WP_201343673.1
Type: Others
Protein ID: WP_201343673.1
Location: 1652670..1652852 (183 bp)
Type: Toxin
Protein ID: WP_014637653.1
Type: Toxin
Protein ID: WP_014637653.1
Location: 1652891..1653343 (453 bp)
Type: Antitoxin
Protein ID: WP_201343674.1
Type: Antitoxin
Protein ID: WP_201343674.1
Location: 1653455..1653664 (210 bp)
Type: Others
Protein ID: WP_201343675.1
Type: Others
Protein ID: WP_201343675.1
Location: 1654109..1654903 (795 bp)
Type: Others
Protein ID: WP_024417690.1
Type: Others
Protein ID: WP_024417690.1
Location: 1654905..1655222 (318 bp)
Type: Others
Protein ID: WP_002936711.1
Type: Others
Protein ID: WP_002936711.1
Location: 1655219..1655383 (165 bp)
Type: Others
Protein ID: WP_002936715.1
Type: Others
Protein ID: WP_002936715.1
Location: 1655573..1657585 (2013 bp)
Type: Others
Protein ID: WP_002936720.1
Type: Others
Protein ID: WP_002936720.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NKZ63_RS08260 (NKZ63_08260) | 1647956..1648228 | + | 273 | WP_226317480.1 | XRE family transcriptional regulator | - |
| NKZ63_RS08265 (NKZ63_08265) | 1648225..1649091 | + | 867 | WP_201343672.1 | primase alpha helix C-terminal domain-containing protein | - |
| NKZ63_RS08270 (NKZ63_08270) | 1649151..1650611 | + | 1461 | WP_201343680.1 | DNA primase family protein | - |
| NKZ63_RS08275 (NKZ63_08275) | 1650947..1651387 | + | 441 | WP_024393720.1 | hypothetical protein | - |
| NKZ63_RS08280 (NKZ63_08280) | 1651457..1651957 | + | 501 | WP_105157412.1 | hypothetical protein | - |
| NKZ63_RS08285 (NKZ63_08285) | 1652098..1652484 | + | 387 | WP_201343673.1 | sigma-70 family RNA polymerase sigma factor | - |
| NKZ63_RS08290 (NKZ63_08290) | 1652670..1652852 | + | 183 | WP_014637653.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NKZ63_RS08295 (NKZ63_08295) | 1652891..1653343 | + | 453 | WP_201343674.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NKZ63_RS08300 (NKZ63_08300) | 1653455..1653664 | + | 210 | WP_201343675.1 | hypothetical protein | - |
| NKZ63_RS08305 (NKZ63_08305) | 1654109..1654903 | - | 795 | WP_024417690.1 | hypothetical protein | - |
| NKZ63_RS08310 (NKZ63_08310) | 1654905..1655222 | - | 318 | WP_002936711.1 | PadR family transcriptional regulator | - |
| NKZ63_RS08315 (NKZ63_08315) | 1655219..1655383 | - | 165 | WP_002936715.1 | hypothetical protein | - |
| NKZ63_RS08320 (NKZ63_08320) | 1655573..1657585 | - | 2013 | WP_002936720.1 | FtsX-like permease family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1637712..1658345 | 20633 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6653.87 Da Isoelectric Point: 10.8207
>T250443 WP_014637653.1 NZ_CP100326:1652670-1652852 [Streptococcus suis]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16671.61 Da Isoelectric Point: 3.9497
>AT250443 WP_201343674.1 NZ_CP100326:1652891-1653343 [Streptococcus suis]
MLVTYPALFYYDDSDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPAPINTLSLANNNPF
RDDEDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDSDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPAPINTLSLANNNPF
RDDEDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G7SGM1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| No matching records found | ||