Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5187029..5187654 | Replicon | chromosome |
Accession | NZ_CP100312 | ||
Organism | Klebsiella pneumoniae strain 1020 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A483GDF6 |
Locus tag | NKX97_RS25265 | Protein ID | WP_004187928.1 |
Coordinates | 5187029..5187412 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NKX97_RS25270 | Protein ID | WP_004150355.1 |
Coordinates | 5187412..5187654 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NKX97_RS25250 (5184395) | 5184395..5185297 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NKX97_RS25255 (5185294) | 5185294..5185929 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NKX97_RS25260 (5185926) | 5185926..5186855 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NKX97_RS25265 (5187029) | 5187029..5187412 | - | 384 | WP_004187928.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NKX97_RS25270 (5187412) | 5187412..5187654 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NKX97_RS25275 (5187848) | 5187848..5188765 | + | 918 | WP_004187929.1 | alpha/beta hydrolase | - |
NKX97_RS25280 (5188779) | 5188779..5189720 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NKX97_RS25285 (5189765) | 5189765..5190202 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NKX97_RS25290 (5190199) | 5190199..5191059 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
NKX97_RS25295 (5191053) | 5191053..5191652 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14407.64 Da Isoelectric Point: 7.3178
>T250436 WP_004187928.1 NZ_CP100312:c5187412-5187029 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483GDF6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |