Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4697696..4698212 | Replicon | chromosome |
| Accession | NZ_CP100312 | ||
| Organism | Klebsiella pneumoniae strain 1020 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A486Q7B5 |
| Locus tag | NKX97_RS22945 | Protein ID | WP_004192395.1 |
| Coordinates | 4697696..4697980 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A483GCT9 |
| Locus tag | NKX97_RS22950 | Protein ID | WP_004192397.1 |
| Coordinates | 4697970..4698212 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NKX97_RS22920 (4693113) | 4693113..4693376 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| NKX97_RS22925 (4693506) | 4693506..4693679 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| NKX97_RS22930 (4693682) | 4693682..4694425 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NKX97_RS22935 (4694782) | 4694782..4696920 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NKX97_RS22940 (4697228) | 4697228..4697692 | + | 465 | WP_004192393.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NKX97_RS22945 (4697696) | 4697696..4697980 | - | 285 | WP_004192395.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NKX97_RS22950 (4697970) | 4697970..4698212 | - | 243 | WP_004192397.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NKX97_RS22955 (4698290) | 4698290..4700200 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| NKX97_RS22960 (4700223) | 4700223..4701377 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| NKX97_RS22965 (4701444) | 4701444..4702184 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11184.03 Da Isoelectric Point: 10.3787
>T250434 WP_004192395.1 NZ_CP100312:c4697980-4697696 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQVNKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQVNKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A486Q7B5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483GCT9 |