Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3973325..3973944 Replicon chromosome
Accession NZ_CP100312
Organism Klebsiella pneumoniae strain 1020

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NKX97_RS19490 Protein ID WP_002892050.1
Coordinates 3973726..3973944 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NKX97_RS19485 Protein ID WP_002892066.1
Coordinates 3973325..3973699 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NKX97_RS19475 (3968477) 3968477..3969670 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NKX97_RS19480 (3969693) 3969693..3972839 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NKX97_RS19485 (3973325) 3973325..3973699 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NKX97_RS19490 (3973726) 3973726..3973944 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NKX97_RS19495 (3974103) 3974103..3974669 + 567 WP_004191639.1 maltose O-acetyltransferase -
NKX97_RS19500 (3974641) 3974641..3974781 - 141 WP_004147370.1 hypothetical protein -
NKX97_RS19505 (3974802) 3974802..3975272 + 471 WP_002892026.1 YlaC family protein -
NKX97_RS19510 (3975247) 3975247..3976698 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NKX97_RS19515 (3976799) 3976799..3977497 + 699 WP_002892021.1 GNAT family protein -
NKX97_RS19520 (3977494) 3977494..3977634 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NKX97_RS19525 (3977634) 3977634..3977897 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250431 WP_002892050.1 NZ_CP100312:3973726-3973944 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250431 WP_002892066.1 NZ_CP100312:3973325-3973699 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References