Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 16575..17311 | Replicon | plasmid pKPN_1021 |
| Accession | NZ_CP100310 | ||
| Organism | Klebsiella pneumoniae strain 1021 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A486JQ35 |
| Locus tag | NKY02_RS26380 | Protein ID | WP_049109282.1 |
| Coordinates | 16829..17311 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | NKY02_RS26375 | Protein ID | WP_003026799.1 |
| Coordinates | 16575..16841 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NKY02_RS26355 (NKY02_26340) | 12655..14211 | - | 1557 | Protein_10 | DUF4158 domain-containing protein | - |
| NKY02_RS26360 (NKY02_26345) | 14265..14969 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NKY02_RS26365 (NKY02_26350) | 15324..16139 | + | 816 | WP_049109278.1 | hypothetical protein | - |
| NKY02_RS26370 (NKY02_26355) | 16182..16289 | - | 108 | Protein_13 | transposase | - |
| NKY02_RS26375 (NKY02_26360) | 16575..16841 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| NKY02_RS26380 (NKY02_26365) | 16829..17311 | + | 483 | WP_049109282.1 | GNAT family N-acetyltransferase | Toxin |
| NKY02_RS26385 (NKY02_26370) | 17511..18914 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| NKY02_RS26390 (NKY02_26375) | 18943..19575 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| NKY02_RS26395 (NKY02_26380) | 19752..21287 | - | 1536 | Protein_18 | IS3 family transposase | - |
| NKY02_RS26400 (NKY02_26385) | 21431..21838 | + | 408 | WP_023304028.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..112694 | 112694 | |
| - | inside | IScluster/Tn | - | - | 12604..20789 | 8185 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17336.86 Da Isoelectric Point: 8.0020
>T250421 WP_049109282.1 NZ_CP100310:16829-17311 [Klebsiella pneumoniae]
VGRITAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCETGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRITAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCETGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A486JQ35 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |