Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 17449..18092 Replicon plasmid pKpQIL_1021
Accession NZ_CP100309
Organism Klebsiella pneumoniae strain 1021

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NKY02_RS25730 Protein ID WP_001044770.1
Coordinates 17676..18092 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NKY02_RS25725 Protein ID WP_001261282.1
Coordinates 17449..17679 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NKY02_RS25685 (NKY02_25670) 12647..13120 + 474 WP_004152341.1 YkgJ family cysteine cluster protein -
NKY02_RS25690 (NKY02_25675) 13212..13442 + 231 WP_011977773.1 hypothetical protein -
NKY02_RS25695 (NKY02_25680) 14334..15116 - 783 WP_004152340.1 site-specific integrase -
NKY02_RS25700 (NKY02_25685) 15116..15448 - 333 WP_004152339.1 hypothetical protein -
NKY02_RS25705 (NKY02_25690) 15455..15853 - 399 WP_004171440.1 hypothetical protein -
NKY02_RS25710 (NKY02_25695) 15879..16208 - 330 WP_004152337.1 hypothetical protein -
NKY02_RS25715 (NKY02_25700) 16236..16544 - 309 WP_004152336.1 hypothetical protein -
NKY02_RS25720 (NKY02_25705) 17031..17492 - 462 WP_072093212.1 hypothetical protein -
NKY02_RS25725 (NKY02_25710) 17449..17679 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NKY02_RS25730 (NKY02_25715) 17676..18092 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NKY02_RS25735 (NKY02_25720) 18166..18855 + 690 Protein_19 ATP-binding protein -
NKY02_RS25740 (NKY02_25725) 18910..19607 + 698 WP_223174630.1 IS1 family transposase -
NKY02_RS25745 (NKY02_25730) 19623..19733 + 111 Protein_21 mercuric transport protein periplasmic component -
NKY02_RS25750 (NKY02_25735) 19769..20191 + 423 WP_001340589.1 organomercurial transporter MerC -
NKY02_RS25755 (NKY02_25740) 20243..21937 + 1695 WP_000105636.1 mercury(II) reductase -
NKY02_RS25760 (NKY02_25745) 21955..22317 + 363 WP_001277456.1 mercury resistance co-regulator MerD -
NKY02_RS25765 (NKY02_25750) 22314..22550 + 237 WP_000993386.1 broad-spectrum mercury transporter MerE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1A / blaOXA-9 / blaKPC-31 - 1..116484 116484
- flank IS/Tn - - 11208..12527 1319


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T250420 WP_001044770.1 NZ_CP100309:17676-18092 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT250420 WP_001261282.1 NZ_CP100309:17449-17679 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References