Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5187478..5188103 | Replicon | chromosome |
| Accession | NZ_CP100308 | ||
| Organism | Klebsiella pneumoniae strain 1021 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A483GDF6 |
| Locus tag | NKY02_RS25275 | Protein ID | WP_004187928.1 |
| Coordinates | 5187478..5187861 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | NKY02_RS25280 | Protein ID | WP_004150355.1 |
| Coordinates | 5187861..5188103 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NKY02_RS25260 (5184844) | 5184844..5185746 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| NKY02_RS25265 (5185743) | 5185743..5186378 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NKY02_RS25270 (5186375) | 5186375..5187304 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| NKY02_RS25275 (5187478) | 5187478..5187861 | - | 384 | WP_004187928.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NKY02_RS25280 (5187861) | 5187861..5188103 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| NKY02_RS25285 (5188297) | 5188297..5189214 | + | 918 | WP_004187929.1 | alpha/beta hydrolase | - |
| NKY02_RS25290 (5189228) | 5189228..5190169 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| NKY02_RS25295 (5190214) | 5190214..5190651 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| NKY02_RS25300 (5190648) | 5190648..5191508 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| NKY02_RS25305 (5191502) | 5191502..5192101 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14407.64 Da Isoelectric Point: 7.3178
>T250419 WP_004187928.1 NZ_CP100308:c5187861-5187478 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483GDF6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |