Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4698889..4699405 | Replicon | chromosome |
| Accession | NZ_CP100308 | ||
| Organism | Klebsiella pneumoniae strain 1021 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A486Q7B5 |
| Locus tag | NKY02_RS22955 | Protein ID | WP_004192395.1 |
| Coordinates | 4698889..4699173 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A483GCT9 |
| Locus tag | NKY02_RS22960 | Protein ID | WP_004192397.1 |
| Coordinates | 4699163..4699405 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NKY02_RS22930 (4694306) | 4694306..4694569 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| NKY02_RS22935 (4694699) | 4694699..4694872 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| NKY02_RS22940 (4694875) | 4694875..4695618 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NKY02_RS22945 (4695975) | 4695975..4698113 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NKY02_RS22950 (4698421) | 4698421..4698885 | + | 465 | WP_004192393.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NKY02_RS22955 (4698889) | 4698889..4699173 | - | 285 | WP_004192395.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NKY02_RS22960 (4699163) | 4699163..4699405 | - | 243 | WP_004192397.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NKY02_RS22965 (4699483) | 4699483..4701393 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| NKY02_RS22970 (4701416) | 4701416..4702570 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| NKY02_RS22975 (4702637) | 4702637..4703377 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11184.03 Da Isoelectric Point: 10.3787
>T250417 WP_004192395.1 NZ_CP100308:c4699173-4698889 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQVNKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQVNKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A486Q7B5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483GCT9 |