Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3974518..3975137 | Replicon | chromosome |
| Accession | NZ_CP100308 | ||
| Organism | Klebsiella pneumoniae strain 1021 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NKY02_RS19500 | Protein ID | WP_002892050.1 |
| Coordinates | 3974919..3975137 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NKY02_RS19495 | Protein ID | WP_002892066.1 |
| Coordinates | 3974518..3974892 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NKY02_RS19485 (3969670) | 3969670..3970863 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NKY02_RS19490 (3970886) | 3970886..3974032 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NKY02_RS19495 (3974518) | 3974518..3974892 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NKY02_RS19500 (3974919) | 3974919..3975137 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NKY02_RS19505 (3975296) | 3975296..3975862 | + | 567 | WP_004191639.1 | maltose O-acetyltransferase | - |
| NKY02_RS19510 (3975834) | 3975834..3975974 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NKY02_RS19515 (3975995) | 3975995..3976465 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| NKY02_RS19520 (3976440) | 3976440..3977891 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| NKY02_RS19525 (3977992) | 3977992..3978690 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| NKY02_RS19530 (3978687) | 3978687..3978827 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NKY02_RS19535 (3978827) | 3978827..3979090 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T250414 WP_002892050.1 NZ_CP100308:3974919-3975137 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT250414 WP_002892066.1 NZ_CP100308:3974518-3974892 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |