Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 2787958..2788611 | Replicon | chromosome |
| Accession | NZ_CP100305 | ||
| Organism | Acinetobacter baumannii strain KBN10P05679 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NIK71_RS13550 | Protein ID | WP_000607077.1 |
| Coordinates | 2787958..2788347 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | NIK71_RS13555 | Protein ID | WP_001288210.1 |
| Coordinates | 2788354..2788611 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIK71_RS13535 (NIK71_13535) | 2783076..2785271 | - | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
| NIK71_RS13540 (NIK71_13540) | 2785459..2786025 | - | 567 | WP_000651538.1 | rhombosortase | - |
| NIK71_RS13545 (NIK71_13545) | 2786103..2787188 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
| NIK71_RS13550 (NIK71_13550) | 2787958..2788347 | - | 390 | WP_000607077.1 | membrane protein | Toxin |
| NIK71_RS13555 (NIK71_13555) | 2788354..2788611 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| NIK71_RS13560 (NIK71_13560) | 2788799..2789971 | + | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
| NIK71_RS13565 (NIK71_13565) | 2790020..2791510 | - | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NIK71_RS13570 (NIK71_13570) | 2791692..2792069 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| NIK71_RS13575 (NIK71_13575) | 2792088..2793095 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T250402 WP_000607077.1 NZ_CP100305:c2788347-2787958 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|